KEGG   Brassica napus (rape): 106400960Help
Entry
106400960         CDS       T04128                                 

Definition
(RefSeq) acid beta-fructofuranosidase 4, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106400960
   00500 Starch and sucrose metabolism
    106400960
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106400960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 106400960
NCBI-ProteinID: XP_013696822
AA seq 663 aa AA seqDB search
MASSDALLPISAREEDPLVSDGSRSDPNAETHRRKRPVKGLLAVSFGLLFIAFYVVLIAT
HHGSSRSNDVKIESDETATTTSRARLAGVSEKSNDQLWKLSGERNTVSFAWNNSVLSWQR
TAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPIA
MVADQWYDANGVWTGSATFLDDGSLVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKYS
GNPVLVPPPGILPKDFRDPTTAWKTSDGKWRITIGSKINKTGISLVYDTIDFKTYEKHDT
LLHKVPNTGMWECVDFYPVSKTAINGLDTSVNGPNVKHIVKASMDDTRFDHYAVGTYFDS
NGTWIPDDPTIDVGMSASLRYDYGKFYASKTFYDQNKGRRILWSWIGESDSEAADVQKGW
SSLQGIPRTVVLDTKTGKNLVQWPVEEIKSLRLSSKQFDMEVGPGSVVPVDVNTATQLDI
EAEFEIKKETLDKILGDSSVVAEAEEFSCQKSGGSTVRGALGPFGFSVLADKSLSEQTPV
YFYVAKGKDSKLKAFFCTDTSRSTFANDVVKPIYGSSVPVLEGEKLTMRILVDHSIVEGF
AQGGRTCITSRVYPTKAIYGAAKLFVFNNAIDATVTASFKVWQMNSAFIHPYSEEAVRAL
SST
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgatgctctcttgccaatctccgccagagaagaagacccattagtatcc
gacgggtcaagatccgaccctaacgcggaaacccatcgccgtaaaagacccgttaaaggt
ctcctcgccgtctcatttgggcttttgtttatcgccttttacgtcgttctcatcgccaca
caccacggatctagtagatccaacgacgttaaaatcgaaagcgatgaaacagcgacgaca
acgtcacgtgcccgtcttgccggcgtatcggagaaaagcaatgatcagttgtggaagctt
tccggtgagcggaatacggtgtcgttcgcttggaacaacagtgtgttgtcatggcaacga
acggcctttcattttcagcctgaacagaattggatgaacgatcctaatggtccattgttc
tacaaaggatggtaccatttcttctaccagtataatccaaacgcagccgtatggggtgat
attgtttggggtcatgccgtgtctaaggacctaatccattgggtccatttgcccatagcc
atggtagctgatcaatggtatgatgccaatggtgtctggacaggctcagccacattcctc
gatgatggctctctcgtcatgttgtacactggttccaccgacaaatccgttcaggtccaa
aatcttgcataccctgaggacctcaacgacccactcctattgaaatgggtcaagtactca
ggcaatccggttctagtacctcctcctggcattctccccaaggacttccgtgacccaacg
actgcatggaagacatcagatggaaaatggcggatcacaatcggttccaagatcaacaaa
accgggatctcactagtgtacgacacaatcgacttcaagacttacgagaaacacgacaca
ttgttgcacaaggttccaaacacggggatgtgggagtgtgttgacttctatccagtgtct
aagaccgcgatcaatgggctcgacacatcagtcaacggaccaaatgtgaagcacatcgtg
aaggctagcatggacgacaccaggtttgatcattatgccgtggggacgtactttgattcg
aacggaacatggatcccggatgatcctactattgatgttgggatgagtgctagtttgaga
tatgattacggaaagttctatgcttcaaagacgttttatgaccaaaacaagggtcgaaga
atcttgtggagttggattggtgaatctgatagtgaggcagctgatgtacaaaagggctgg
tcttctcttcagggtatcccaagaaccgttgttctcgacacaaagacagggaagaacttg
gtccaatggccagtggaagaaataaaatcccttagattaagcagcaagcaatttgatatg
gaagttggtcctggttcagtggtaccggtcgatgtgaataccgcaactcagctagacatt
gaagcagagttcgagatcaagaaagagactcttgacaaaatccttggagattcatcggtg
gtggctgaagctgaggagtttagctgccagaagagcggtggatctactgtccgtggtgcg
ttaggaccgtttggattctcggttctcgccgataagagcttgtcggagcaaactccggtt
tacttctacgtggctaagggaaaagattccaagctcaaagctttcttctgcacagatact
tcaaggtcaacgtttgccaacgatgtcgttaagccgatttatggtagttctgtaccggtt
ctagaaggagagaaattgaccatgagaatactggtggatcattcgatagtagaaggattc
gcacaaggtggaagaacatgcataacgtcaagggtatatccaacaaaagccatctatgga
gcagctaagctttttgtattcaacaatgccattgatgcgactgttacggcgtcgttcaaa
gtctggcaaatgaacagtgcttttattcacccttactctgaggaagctgtccgtgctctc
tccagcacctga

DBGET integrated database retrieval system