KEGG   Brassica napus (rape): 106400975Help
Entry
106400975         CDS       T04128                                 

Definition
(RefSeq) acid beta-fructofuranosidase 4, vacuolar
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106400975
   00500 Starch and sucrose metabolism
    106400975
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106400975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 106400975
NCBI-ProteinID: XP_013696842
UniProt: A0A078GX32
AA seq 659 aa AA seqDB search
MASSDALLPISAREEDPLLSDGSRSDPNAETHGRRRPVKGLLAVSFGLFFIAFYVALIAT
HDGSRSNDVKIESDGTATTVSRAHLAGVSEKSNDQLWKLSGDRNTVAFSWNNSMLSWQRT
AFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSKDLIHWVHLPLAM
VADQWYDANGVWTGSATFLEDGSIVMLYTGSTDKSVQVQNLAYPEDLNDPLLLKWVKFPG
NPVLVPPPGILPKDFRDPTTAWKTSAGKWRITIGSKINRTGISLVYDTTDFKTYEKLETL
LHKVPNTGMWECVDFYPVSKTLVKGLDTSVNGPDVKHIVKASMDDTRIDHYAIGTYFDSN
GTWTPDDPTIDVGISTSLRYDYGKFYASKTFYDQNKGRRILWGWIGESDSESADVQKGWS
SLQGIPRTVVLDTKTGKNLVQWPVEEVKSLRLSSKKFDMEVGPGSLVHIDVGSAAQLDIE
AEFEIKKESLDKILGDASATEEFSCQKSGGSTVRGALGPFGFSVLAHESLSEQTPVYFYV
AKGKDSKLTTFFCADSSRSSFANDVVKPIYGSSVPVLKGEKLTMRILVDHSIVEAFGQGG
RTCITSRVYPTKAIYGAAKLFLFNNAIDATITASFKVWQMNSAFIQPYSEEAVRALSRT
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctctgacgctctcttgccaatctccgccagagaagaagatcctctattatcc
gacgggtcaagatccgacccaaatgcggaaacccatggccgtagaagacccgtgaaaggt
ctcctcgccgtctcatttgggcttttctttatcgccttctacgtcgctctcatcgccaca
cacgacggatctagatccaacgacgttaagatcgaaagcgatggaacagcgaccacagtg
tcacgtgcccatctcgccggcgtctcggagaaaagcaatgatcagttgtggaagctttcc
ggtgacaggaatacggtggcgttctcatggaacaacagtatgttgtcgtggcaacgaacg
gcgtttcatttccaacctgaacagaactggatgaacgatcctaatggtccattgttctac
aaaggatggtaccatttcttctaccagtacaacccaaacgcagcagtatggggtgacatt
gtttggggtcatgccgtgtctaaggacctaattcattgggtccatttgcccttagctatg
gttgctgatcaatggtacgatgccaatggtgtatggaccggctcagccacattcctcgaa
gatggctcgatcgtcatgctctacaccggttctaccgacaaatccgtgcaggtccaaaac
cttgcctaccctgaggacctgaacgacccacttctactgaaatgggtcaagttcccgggc
aacccggttcttgtacctccaccgggtattctccccaaggacttccgtgacccaacaact
gcatggaagacatcggccggaaaatggcggatcactattggttccaagatcaacagaacc
gggatctcactcgtgtacgacacgactgacttcaagacttacgagaaactcgagacgttg
ttgcacaaagttccaaacactgggatgtgggagtgtgttgacttttatccagtgtctaag
accttggtcaaggggctagacacatcggtcaatggaccagatgtgaagcacatcgtgaag
gctagtatggacgacaccaggatcgatcattatgccatagggacatattttgattcgaac
gggacatggaccccggatgatcctactattgatgttgggattagtactagtttaagatat
gattacggaaagttttatgcgtcaaagacgttttatgaccagaacaagggtaggagaatc
ttgtggggttggattggtgaatctgatagtgagtctgctgatgtacaaaagggctggtct
tctcttcagggtatcccaagaaccgttgttctcgacacaaagacaggtaagaacttggtt
caatggccagtggaagaagtaaaatctcttagattaagcagcaagaagtttgatatggaa
gtcggtcctggatcgttggtacacattgatgtgggttctgcggctcagctcgatattgaa
gcagagttcgagatcaagaaagaatctcttgacaaaatcctcggcgacgcttcggcaaca
gaggaatttagctgccagaaaagcggaggatccaccgttcgtggtgctttgggaccgttt
ggtttctcggttctcgcccatgagagcttgtcggagcaaactccggtttacttctatgtg
gctaagggaaaagattctaagctcacaacattcttctgtgcagacagctcaaggtcatct
tttgcaaacgatgtcgttaagccgatttatggtagttctgtaccggttctgaaaggggag
aaactgaccatgagaatattggtggatcattcgatagtagaagcattcggacaaggtgga
agaacatgcataacgtcaagggtatatccaacaaaggccatctatggagcagcgaagctt
ttcttgttcaacaatgccattgatgcgactattacggcatcgtttaaggtgtggcagatg
aacagtgcttttattcagccttactctgaggaggctgttcgtgctctctcccgcacatga

DBGET integrated database retrieval system