KEGG   Brassica napus (rape): 106401277Help
Entry
106401277         CDS       T04128                                 

Definition
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal-like
  KO
K01913  acetate/butyrate---CoA ligase [EC:6.2.1.1 6.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00620  Pyruvate metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106401277
   00620 Pyruvate metabolism
    106401277
   00630 Glyoxylate and dicarboxylate metabolism
    106401277
   00650 Butanoate metabolism
    106401277
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bna01004]
    106401277
Enzymes [BR:bna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     106401277
    6.2.1.2  medium-chain acyl-CoA ligase
     106401277
Lipid biosynthesis proteins [BR:bna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   106401277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 106401277
NCBI-ProteinID: XP_013697216
AA seq 569 aa AA seqDB search
MAATKSRDIDDLPKIQANYTALTPLWFLDRAAAVHPTRKSLIHGSREYTWRQTYERCRRL
ASALADRSIGPGSTVAVIAPNTPAMYEAHFGIPMCGAVLNAVNIRLNAPTIAFLLGHSQS
AVIMVDQEFFTLAEESLRLMEEKAGSSFKRPLLIVIGDHTCHPESLHRALSKGVVEYEDF
LGSGDPNYAWETPADEWQSIALGSPSGPTASPKGVVLHHRGAYLMALSNPLIWGMQEGSV
YLWTLPMFHCNGWCFTWALAALSGTNICLRQVTAKEVYSSIAKYNVTHFCAAPVVLNNIV
NAPQEDTILPLPHTVHVMTAGAAPPPSVLFSMNQKGFRVTHTYGLSETYGPSTVAAWKPE
WDSLPPETQAKLNARQGVRYICMEQLDVIDTQTGKPVPADGKTAGEIVFRGNMVMKGYLK
NPKANEETFAGGWFHSGDIAVKHPDNYIEIKDRSKDIIISGGENISSVEVENVVYHHPAV
LEASVVARPDERWQESPCAFVTVKRGYEKQDQKKLAQDIMKFCKEKLPAYWVPKSVVFGP
LPKTATGKIQKHVLRTKAKEMGPVPRSRL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacaaagtctcgtgacatcgacgaccttccgaaaattcaggcgaactacacc
gcgttgacgccgctctggttcttagacagggctgcggcggttcatccgacgaggaaatcg
ctgattcacggatcgcgggagtacacgtggcggcagacttacgagcgatgtcgccgcctc
gcttccgctctcgcggatcgttcgattggccctggttccacggtggctgtaattgcaccc
aacactccagcaatgtacgaagctcatttcggaataccaatgtgtggagccgtcttgaac
gccgtcaacatccgtctcaacgcccccactatcgctttccttctcggacactctcagagc
gctgttatcatggtggatcaagagttcttcactcttgcagaggagtctttgagacttatg
gaggagaaagctgggagcagcttcaaacgcccgctcctaatcgtcataggtgatcacacc
tgtcatccagagtcgcttcaccgggctttgtcgaaaggagttgtagaatacgaggatttt
cttggaagtggagatcctaactatgcgtgggagacaccagctgatgagtggcagagtatt
gctctgggttccccctcgggaccaaccgctagcccgaaaggtgtggtgcttcatcatcga
ggagcgtatctaatggctttaagcaatcctcttatttgggggatgcaagaaggctctgtt
tacttgtggactctccctatgtttcattgcaatggttggtgtttcacttgggctcttgct
gcgctctccggtactaacatctgtctccgtcaggtcacggcgaaagaagtgtattcgagc
atagccaagtataacgttacccatttctgtgcggctcctgtggtcctcaacaatattgtc
aatgctcctcaagaggacactatccttcctcttccccatacggtccacgtcatgaccgca
ggagctgctcctccaccttctgttctcttctccatgaaccagaagggcttccgagtcact
cacacctatgggctatccgagacgtacggtccttccaccgtagccgcctggaagcccgag
tgggactccctccctcctgagacgcaggccaagctcaatgctcgccaaggtgtccgctac
atctgcatggagcagcttgatgtcatcgacactcagacaggaaaacctgttcctgcagac
ggtaaaaccgccggagagattgttttccgagggaacatggtgatgaaaggatacttaaag
aatcctaaagctaacgaggagactttcgctggtgggtggttccattcaggggatatcgcg
gtgaaacatccagacaactacatcgagatcaaggacaggtcgaaggacattataatctcc
ggcggtgagaacatcagcagcgtggaggtcgaaaacgttgtttaccatcacccggcggtt
cttgaagcctctgttgtggccaggccagacgagcggtggcaggaatctccgtgtgctttt
gtgacggtcaagaggggttacgagaagcaagaccagaaaaagttggctcaggatataatg
aaattctgcaaggagaagctgccggcgtactgggtcccaaagtcggtggtgtttgggcca
ttaccgaagacggctactggaaagattcagaagcatgtattgaggactaaggcgaaagag
atgggaccagtaccaagaagcaggttgtag

KEGG   Brassica napus (rape): 106420757Help
Entry
106420757         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal isoform X1
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00620  Pyruvate metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106420757
   00620 Pyruvate metabolism
    106420757
   00630 Glyoxylate and dicarboxylate metabolism
    106420757
   00640 Propanoate metabolism
    106420757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bna01004]
    106420757
Enzymes [BR:bna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     106420757
Lipid biosynthesis proteins [BR:bna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   106420757
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 106420757
NCBI-ProteinID: XP_013717053
AA seq 747 aa AA seqDB search
MKIGCSSSSSSPLLAVVSISGSSDLKTSGSLGSRILPASQSRSSPLDRLLRCKTMSSNHL
RHVESMSLLPSGAGKISQLNAVVLGESIASEENDLVFPSKEFSSQALVSSPQQYMEMHKR
SMEDPAGFWSGIASEFHWKQKWGDQVVSENLDVRKGPIHIEWFKGGITNICYNCLDKNVE
AGLGDKTAMFWEGNERDVDASLTYSQLLQQVCQLANYLKDVGVKKGDAVVIYLPMLMELP
IAMLACARIGAVHSVVFAGFSADSLAQRIIDCKPKLILTCNAVKRGPKTINLKAIVDAAL
DISSKDGVSVDVCLTYDNSSATTRENTKWQNGRDVWWQDVIPKYPTSCEVEWVDAEDPLF
LLYTSGSTGKPKGVLHTTGGYMVYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGP
MLNGATVVVFEGTPNYPDSGRCWEIVDKYKVSIFYTAPTLVRSLMRDDDKFVTNHSRKSL
RVLGSVGEPINPSAWRWFFNLVGDSRCPISDTWWQTETGGFMLTPLPGAWPQKPGSATFP
FFGVQPVIVDEKGNEIEGECSGFLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGD
GCSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALASHPQCAEAAVVGVEHEVKGQGIY
AFVTLVEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIAS
RQLEELGDISTLADPSVVDQLIALADA
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggttgttcttcgtcttcttcttctccgcttctcgccgttgtctccatctca
ggctcatcggatctgaaaacaagcggatcacttggatctcggattcttccggcttctcaa
agcagatcatccccgttggacagacttctccggtgtaagacaatgtcatccaatcaccta
aggcatgttgagtcaatgtccctgctaccctcaggtgccggcaagatctctcagttaaac
gctgtggtcttaggtgaatccattgcctctgaggagaatgatctcgtctttcccagcaag
gaattctccagccaggctcttgtctcctcccctcaacagtacatggagatgcacaagagg
tcgatggaggaccctgcagggttctggtctggcattgcgtctgagtttcactggaagcag
aaatggggtgaccaagtggtctccgagaatctcgatgtcaggaagggtcctattcacatt
gagtggttcaaggggggaatcaccaacatctgctacaactgcttagacaaaaatgttgaa
gctggtttgggtgataaaacagctatgttctgggaagggaatgaacgtgatgtagatgct
tccttgacttattctcagttgcttcaacaagtttgccagcttgctaattacttgaaagat
gttggagtgaagaagggagatgccgttgtaatttacttaccaatgttgatggaacttcct
atcgctatgcttgcttgtgcacgcatcggagctgttcattcggtcgtttttgctggattt
tctgctgactctcttgcccaaagaatcattgattgcaagccaaaactgatactgacttgc
aatgctgttaaaagaggccctaagaccattaatcttaaagctattgttgatgctgctctt
gacatctcctctaaagatggagtctctgtagacgtatgcttgacctatgacaactcatca
gcgacaacaagggaaaatacaaaatggcagaatggaagagatgtgtggtggcaggatgtt
attcccaaatatccaacatcatgtgaggtggaatgggttgatgcggaagatccattattt
ttactctacaccagtggaagcaccggcaagcccaagggtgtcctacacacaactggaggg
tatatggtctacactgctacaacattcaaatatgcatttgactacaaatcaacagatgta
tactggtgtacagcagattgtggttggatcactggccatagctatgttacctatggaccg
atgctcaatggagccactgttgttgtctttgaagggactccaaactaccctgattctgga
cgctgttgggaaattgttgacaaatacaaggtttccatattttacactgctccaacattg
gtgaggtctctcatgcgcgatgatgataagtttgtgacaaatcattctcgcaaatcgcta
cgagtccttggaagtgtgggtgagcccatcaatccgagtgcatggagatggttcttcaat
ctagttggtgattcaagatgtcccatttccgatacgtggtggcaaactgaaactggtggc
ttcatgttaaccccattgccaggtgcttggccgcagaagcctggttcagctactttccct
ttctttggtgttcagcctgtcatagttgatgaaaaaggcaatgaaatcgaaggcgagtgt
agtggttttctttgtgtgaaaggatcatggcccggggcgtttcgaactctgtttggggat
catgaaagatatgaaaccacgtacttcaaaccttttgctggatactattttagtggtgat
ggttgcagcagagacaaggatggttactactggcttacagggagggttgatgatgttatc
aacgtcagtggccaccgcattggaactgctgaagtggaatctgctctggcttcacatccc
caatgtgcagaggcagctgttgtaggtgtagaacatgaggtgaaaggtcagggtatctat
gcgtttgtcactcttgtggagggtgttccttacagcgaagagcttcggaaaagccttgta
ctcatggtccgaaaccagattggggcatttgcagcaccggacagaatacattgggcacca
gggttgccaaagacaagaagtggaaagataatgaggagaatcctgagaaagatcgcttca
aggcaattagaagagcttggagatattagcacactcgctgatcctagtgtcgttgatcag
cttattgcacttgccgatgcgtga

KEGG   Brassica napus (rape): 106446375Help
Entry
106446375         CDS       T04128                                 

Definition
(RefSeq) acetyl-coenzyme A synthetase, chloroplastic/glyoxysomal-like
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00620  Pyruvate metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106446375
   00620 Pyruvate metabolism
    106446375
   00630 Glyoxylate and dicarboxylate metabolism
    106446375
   00640 Propanoate metabolism
    106446375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bna01004]
    106446375
Enzymes [BR:bna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     106446375
Lipid biosynthesis proteins [BR:bna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   106446375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 106446375
NCBI-ProteinID: XP_013743541
AA seq 746 aa AA seqDB search
MKIGCSSSSSSPLLAVVSCSGSSDLKTSGSLGSRILPASQRSSPLDKLLRCKTMSSNHLR
HVESMSLLPSGAGKISQLNAVVLGESIASEENDLVFPSKEFSSQALVSSPQQYMEMHKRS
MEDPTGFWSDIASEFYWKQKWGDRVVSENLDVRKGPIHIEWFKGGITNICYNCLDRNVEA
GLGDKTAMFWEGNERDVDASLTYSQLLQQVCQLANYLKDVGVKKGDAVVIYLPMLMELPI
AMLACARIGAVHSVVFAGFSADSLAQRIIDCKPKLILTCNAVKRGPKTINLKAIVDAALD
ISSKDGVSVDVCLTYDNSSATTREDTKWQNGRDVWWQDVVPKYPTSCEVEWVDAEDPLFL
LYTSGSTGKPKGVLHTTGGYMVYTATTFKYAFDYKSTDVYWCTADCGWITGHSYVTYGPM
LNGATVVVFEGTPNYPDSGRCWEIVDKFKVSIFYTAPTLVRSLMRDDDKFVTNHSRKSLR
VLGSVGEPINPSAWRWFFNLVGDSRCPISDTWWQTETGGFMISPLPGAWPQKPGSATFPF
FGVQPVVVDEKGNEIEGECSGYLCVKGSWPGAFRTLFGDHERYETTYFKPFAGYYFSGDG
CSRDKDGYYWLTGRVDDVINVSGHRIGTAEVESALASHPQCAEAAVVGVEHEVKGQGIYA
FVTLVEGVPYSEELRKSLVLMVRNQIGAFAAPDRIHWAPGLPKTRSGKIMRRILRKIASR
QLEELGDISTLADPSVVDQLIALADV
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggctgttcttcgtcttcttcttctccgcttctcgccgttgtctcctgctca
ggctcatcggatctgaaaacaagcggatcacttggatctcggattcttccggcttctcaa
agatcatctccgttggacaaacttctccggtgtaagacaatgtcatccaatcacctaagg
catgtggagtccatgtccttgctaccctcaggtgccggcaagatctctcagttaaacgct
gtggtcttaggtgaatccattgcctctgaggagaatgatctcgtcttccccagcaaggag
ttctcctcccaggctcttgtctcctcccctcaacagtacatggagatgcacaagaggtcg
atggaggaccctaccgggttttggtctgacattgcgtctgagttttactggaagcagaaa
tggggtgaccgagtggtttccgagaatctcgatgtcaggaagggtcctattcacatcgag
tggttcaaggggggaatcaccaacatctgctacaactgcttagacagaaatgttgaagct
ggtttgggtgataaaacagctatgttctgggaagggaatgaacgtgatgtagatgcttcc
ttaacttattctcagttgcttcaacaagtttgccagcttgctaattacttgaaagatgtt
ggagtgaagaagggagatgccgttgtaatttacttaccaatgttaatggaacttcctatc
gctatgcttgcttgtgcacgcatcggagctgttcattcggtcgtttttgctggattttct
gctgactcgcttgcccaaagaatcattgattgcaagccaaaactaatactgacttgcaat
gctgttaaaagaggccctaagaccattaaccttaaagctattgttgatgctgctcttgac
atttcctctaaagatggagtctctgtagacgtatgcttgacctatgacaactcatcggcg
acaacaagggaagatactaaatggcagaatggaagagatgtgtggtggcaggatgttgtt
cctaaatatccaacatcgtgtgaggtggaatgggttgatgcggaagatccattatttcta
ctctacaccagtggaagcaccggcaagccaaagggtgtcctacacacaactggagggtat
atggtctacactgctacaacattcaaatatgcatttgactacaaatcaacagatgtatac
tggtgtacagcagattgtggttggatcactggccatagctatgttacctatggaccgatg
ctcaatggagccactgttgttgtctttgaagggactccaaactaccctgactctggacgc
tgttgggaaattgttgacaaattcaaggtttccatattttacactgctccaacgttggtg
aggtctctcatgcgcgatgatgataagtttgtgacaaatcattctcgcaaatcgctacga
gtccttggaagtgtgggtgagcccatcaatccgagtgcatggagatggttcttcaatcta
gttggtgattcaaggtgccccatttccgatacgtggtggcaaactgaaactggtggcttc
atgatatccccgttgccaggtgcttggccgcagaagcctggttcagctactttccctttc
tttggtgtacagcctgtcgtagttgatgaaaaaggcaatgaaatcgaaggcgagtgcagt
ggttatctttgtgtgaaagggtcatggcccggggcgtttcgaactttgtttggggatcat
gaaagatatgaaaccacatacttcaaaccttttgctggatactattttagtggtgatggt
tgcagcagagacaaggatggttactactggcttacagggagggtcgatgatgttatcaac
gtcagtggccaccgcattggaactgctgaagtggaatctgctctggcttcacatccccaa
tgtgcagaggcagctgttgtaggtgtagaacatgaggtgaaaggtcagggtatctatgcg
tttgtcactcttgtagagggtgttccttacagcgaagagcttcggaaaagccttgtactc
atggtccgaaaccagattggggcatttgcagcaccggacagaatacattgggcaccaggg
ttgccaaagacaagaagtggaaagataatgaggagaatcctgagaaagatcgcttcaagg
caattagaagagcttggagatattagcacactcgcagatcctagtgttgttgatcagctt
attgcacttgccgatgtgtga

KEGG   Brassica napus (rape): 106452074Help
Entry
106452074         CDS       T04128                                 

Definition
(RefSeq) acetate/butyrate--CoA ligase AAE7, peroxisomal isoform X1
  KO
K01913  acetate/butyrate---CoA ligase [EC:6.2.1.1 6.2.1.2]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00620  Pyruvate metabolism
bna00630  Glyoxylate and dicarboxylate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106452074
   00620 Pyruvate metabolism
    106452074
   00630 Glyoxylate and dicarboxylate metabolism
    106452074
   00650 Butanoate metabolism
    106452074
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bna01004]
    106452074
Enzymes [BR:bna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     106452074
    6.2.1.2  medium-chain acyl-CoA ligase
     106452074
Lipid biosynthesis proteins [BR:bna01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   106452074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-GeneID: 106452074
NCBI-ProteinID: XP_013749547
AA seq 569 aa AA seqDB search
MAATKSRDIDDLPKIQANYTALTPLWFLDRAAAVHPTRKSLIHGSLEYTWRQTYERCRRL
ASALADRSIGPGSTVAVIAPNTPAMYEAHFGIPMCGAVLNAVNIRLNAPTIAFLLGHSQS
AVIMVDQEFFTLAEESLRLMEEKAGSSFKRPLLIVIGDHTCPPESLNRALSKGVVEYEDF
LGSGDPNYAWETPADEWQSIALGYTSGTTASPKGVVLHHRGAYLMALSNPLIWGMQEGSV
YLWTLPMFHCNGWCFTWALAALSGTNICLRQVTAKEVYSSIAKYNVTHFCAAPVVLNTIV
NAPQEDTILPLPHTVHVMTAGAAPPPSVLFSMNQKGFRVTHTYGLSETYGPSTVAAWKPE
WDSLPPETQAKLNARQGVRYIGMEQLDVIDTQTGKPVPADGKTAGEIVFRGNMVMKGYLK
NPKANEETFAGGWFHSGDIAVKHPDNYIEIKDRSKDIIISGGENISSVEVENVVYHHPAV
LEASVVARPDERWQESPCAFVTVKSGYEKQDQNNLAQDIMKFCKEKLPAYWVPKSVVFGP
LPKTATGKIQKHVLRTKAKELGPVPRSRL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactaagtctcgtgacatcgacgaccttccgaaaattcaggcgaactacacc
gcgttgacgccgctctggttcttagacagggctgcggcggttcatccgacgaggaaatcg
ctgattcacggatccttggagtacacgtggcggcagacttacgagcgatgtcgccgtcta
gcctccgctctcgccgatcgttcgattggacctggctccacggtggctgtaattgcaccc
aacactccagcaatgtacgaagctcatttcggaataccaatgtgtggagccgtcttgaac
gccgtcaacatccgtctcaacgcccccactatcgctttccttctcggccactctcagagc
gctgttatcatggtggatcaagagtttttcactcttgcagaggagtctttgagactcatg
gaggagaaagctgggagcagcttcaaacgcccgctcctaatcgtcataggtgatcacact
tgtccaccagagtcgcttaaccgggctttgtcgaaaggagtcgtagaatacgaggatttt
cttggaagtggagatcctaactatgcttgggagacaccagctgatgagtggcagagtatt
gctcttggttacacctcgggaacaaccgctagcccgaaaggtgtggtgcttcatcatcga
ggagcgtatctaatggctttgagtaatcctcttatttgggggatgcaagaaggttctgtt
tacttgtggacgctccctatgtttcattgtaatggttggtgtttcacttgggctcttgct
gcactctccggtactaacatctgtctccgtcaggtcacggcgaaagaagtgtattcgagc
atagccaagtataacgttacccatttctgtgcggctcctgtggtcctcaacactattgtc
aatgctcctcaagaggacactatccttccccttccacatacagtccatgtcatgaccgca
ggagctgctcctccaccttctgttctcttctccatgaaccagaagggcttccgagtcact
cacacctatgggctatccgagacgtatggcccttccaccgtagccgcttggaagcccgag
tgggattccctccctcccgagacgcaggccaagctcaatgctcgccaaggtgtccgctac
atcggcatggagcagcttgatgtaatcgacactcagacaggaaaacctgttcctgcagac
ggtaaaaccgctggagagattgttttccgagggaacatggtgatgaaaggctacctaaag
aacccaaaagctaacgaggagacgtttgctggcgggtggttccattcaggggacatcgcg
gtgaaacatccagacaactacatcgagataaaggacaggtcaaaggacattataatatcc
ggtggtgagaacatcagcagcgtggaggtggaaaacgtcgtgtatcatcacccggcggtg
cttgaagcctctgttgtggccaggccagacgagcggtggcaggaatctccgtgtgctttt
gtgacggtcaagagcggttacgagaaacaagaccagaataatttggctcaggatataatg
aaattctgcaaggagaagctgccggcgtactgggttccgaagtcggtggtgtttgggccg
ttaccgaagactgctactggaaagattcagaagcatgttttgaggactaaggcgaaagag
ttaggaccagtaccaagaagcaggttgtag

DBGET integrated database retrieval system