KEGG   Brassica napus (rape): 106402248Help
Entry
106402248         CDS       T04128                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106402248
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106402248
Enzymes [BR:bna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106402248
Spliceosome [BR:bna03041]
 Complex C
  Other components
   Step II factors
    106402248
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD AAA_19 AAA_30 T2SSE PhoH FtsK_SpoIIIE AAA_24 AAA_23 ABC_tran
Motif
Other DBs
NCBI-GeneID: 106402248
NCBI-ProteinID: XP_013698397
AA seq 722 aa AA seqDB search
MPSMAQGELKSSVLNSKSPIASRFRMRQKIAEHRKSLPIASVEKRLIEEVQKNDILIIVG
ETGSGKTTQLPQFLFSAGFCREGKMVGITQPRRIAAVTIAKRVAEESDVELGQRVGYSIR
FDDCTSSYTRLKYMTDGFLLREALLDPLLSRYSVIIVDEAHERTVHTDVLLALLKEVQRA
RSKHEGVQTKAGDEIGVKRNGGVLRVCQGRKVSPLKLIIMSASLDARVFSEYFGGAKAVH
VEGRQFPVDIFYTVHPETDYVDAALVTIFQIHVEEKPGDILVFLTGQDEIESVERLVKER
LEHLPEDKRKLLPLAIFSALPSEQQMQVFAPAPTGFRKVILATNIAETSITIPGIRYVID
PGFVKARTYDPSKGMETLDVVPASKAQSLQRSGRAGREGPGKCFRLYPEREFEKLEDSTK
PEIKRCNLSNVILQLKALGIDDIVGFDFIDKPSRGAIVKALTELRLLGALTDDCKLEKPA
GEQMSRLPLDPVYSRALILANNQFNCLEEMLITVAMLSVESIFYDPREKREEARTSRNHF
ASVEGDHLTYLSVYRESNEFLEKRKTESSEAKIDKIMKKWCKDNFVNNRSLKHARDTYRQ
IREHVEQMGFNVSSCGNDMLEYRRCLAASFFLKAAQRQMDGTYRALESGEIVHIHPTSVL
FRSKPECVIFNELMQTSKKYIKNLTRIDHLWLAELAPHHYKTDDEMNDLTQEMECCRLKL
SK
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgccatcaatggcgcaaggagaactcaagagctctgtactaaacagtaaatccccaatt
gcttcacgcttcagaatgaggcagaagatagcagaacatagaaagtctcttcctattgct
tcagtggagaagcgtttgattgaggaggttcaaaagaatgatattttgattattgttggt
gaaaccggtagtgggaagactactcagctgcctcagtttctattcagcgctggattctgc
agggaagggaagatggtggggataacacagccgaggcgtatcgctgctgtgactattgcc
aaaagggtagctgaggagagtgatgttgagttgggccaaagggttggttattccattagg
tttgatgattgcacttctagctacacgaggttgaagtacatgactgatgggtttttgttg
agggaagctttgttggatccgcttctttctagatattcagttattattgtcgatgaagcc
catgagaggactgttcacactgatgttctgcttgcattgctgaaagaggtgcagcgggct
cggtcaaagcacgaaggagtacaaacaaaagcaggtgatgagattggtgtgaagcggaac
ggtggtgtgttaagagtgtgccaaggcaggaaagtatctccgttgaagctgataatcatg
tctgctagtttggatgcacgtgttttctctgagtactttggtggtgccaaagctgttcat
gtggaagggagacagtttcccgttgacattttttacacagtccatcccgaaacagattat
gtggacgcagctttggtcactatattccagattcatgtggaagagaagccaggtgatata
cttgttttcctcaccgggcaagatgagattgaatctgttgaaagacttgtcaaagaaaga
cttgagcatttacctgaagacaagaggaagctgctgccacttgctatcttctctgctctt
ccatcagagcagcaaatgcaagtttttgcccctgcgccaactggttttcgtaaggtgatt
ttggccacaaacatagcggaaacatcgattacaattcctggaataagatatgtgatagac
cctgggtttgtcaaggcacgaacctatgatccaagcaaaggtatggagacgcttgatgtt
gttccagcatcaaaagcacagtcgcttcaaagaagtggacgtgcaggacgtgagggtcct
ggcaaatgttttcgtctttatcccgaaagggaatttgagaagctggaggattcaaccaaa
ccagagatcaagagatgcaatctctctaatgtcattttgcagctcaaggctctgggaatt
gatgacattgttggatttgactttatagataaaccttctaggggcgccatagtgaaggca
ttgaccgagttgcgcttgctaggtgccttgacggatgattgcaaactagagaaacccgcc
ggagaacaaatgtcacggctcccactagatcctgtctactccagagctctaattttggcc
aataatcagttcaactgtctcgaggaaatgttaatcacggttgcaatgctctctgtggaa
tccatattttatgatcctcgtgagaagagagaagaggcaagaacctcaagaaaccacttt
gctagcgttgaaggggatcatctcacttatcttagcgtataccgagagtcaaatgagttc
ttggagaagagaaagacagaaagcagtgaagccaaaattgataaaatcatgaaaaaatgg
tgcaaggacaacttcgtgaataatcgttccttgaaacatgcccgtgacacttacagacaa
attcgtgaacatgttgaacagatggggtttaatgtgtcttcgtgtgggaacgacatgctc
gagtatcgtagatgtcttgctgcgtcgtttttccttaaagcagcacagagacagatggat
gggacatacagggcgttggaaagtggggagattgtccacatccacccaacttctgtttta
ttccgttcgaaacccgagtgcgttatcttcaacgagctcatgcaaaccagcaagaagtac
attaagaacctgacgagaattgatcatttatggttggctgagttggctcctcatcattac
aaaacagatgatgagatgaatgacttaacacaagagatggaatgttgcagactgaagctt
tctaaatga

DBGET integrated database retrieval system