KEGG   Brassica napus (rape): 106407245Help
Entry
106407245         CDS       T04128                                 

Definition
(RefSeq) gamma-glutamyltranspeptidase 3-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
bna  Brassica napus (rape)
Pathway
bna00430  Taurine and hypotaurine metabolism
bna00460  Cyanoamino acid metabolism
bna00480  Glutathione metabolism
bna00590  Arachidonic acid metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106407245
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    106407245
   00460 Cyanoamino acid metabolism
    106407245
   00480 Glutathione metabolism
    106407245
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bna01002]
    106407245
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:bna04090]
    106407245
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     106407245
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     106407245
    3.4.19.14  leukotriene-C4 hydrolase
     106407245
Peptidases and inhibitors [BR:bna01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   106407245
CD molecules [BR:bna04090]
 Proteins
  106407245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 106407245
NCBI-ProteinID: XP_013703535
AA seq 433 aa AA seqDB search
MGRGTMRDPFLDIEKSDTTISDVNKNRPRRSQIAIALCLSLFLVGGAGFTWTRYFTGEET
ETKSNDEDFVVTSKTGVVAADHETCSEIGADGLRRLDGSAVDAAVAVAFCLGVVNPTSSG
IGGGAFMVVGSASGSAIAYDMRETASSTAYKEMFEGRVDKQQKGPLSVAVPGEVAGLYQA
WTNNGRRVQWKQLVEPSIKLARDGFVVGPHLAFALSTYEEKIRNDTGLKSIFVIGDKLST
EGDTCKNIKLAETLEKVAEKGMQAFYQDDVAENLVNDLMHAGGNMTLEDLRDYKVNVTDA
MVVNDVMGFKLQGMWPPSSGTAGFAMVMNILEQYTDIDGIDKNLFLHRVIEAIKFMLAAR
MDLGDPAFVEGISEVVKNMTSKSWAQNIQEKISDDKTYPPDYYRNKYKQLKDEGTSHFCV
VRSVSCNINTFQV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgggtcggggtacaatgcgagatccatttttggacatcgaaaagtcggacaccacgatt
tctgacgtcaataaaaataggccaagaagaagtcagattgcaattgcattgtgtttgtct
ctctttcttgtcggaggcgcaggttttacgtggaccagatattttactggcgaagaaaca
gaaaccaaaagcaatgacgaagacttcgttgtgacgtcgaaaaccggcgtcgtggcggcc
gaccacgagacatgttcagagattggcgcggacgggctaagacgactcgacggctccgcc
gtagacgccgcagtggccgtcgcattttgcttaggtgtcgtgaatcctacgtctagtgga
atcggtggtggagccttcatggtcgtcggctctgcatccggttcggcgatagcttatgac
atgcgagaaaccgcttcttccactgcgtacaaggaaatgttcgagggcagagtggacaag
caacaaaaaggaccattatctgtggcagttccaggagaggtagccggtctttaccaagcg
tggacgaacaacggccgccgtgtccagtggaaacagctggtcgagccgtctattaaactt
gctcgagacggtttcgtggttggtccgcatctcgccttcgcgttatccacctacgaggaa
aagatcaggaacgatactggtttaaagagtattttcgttatcggagacaaattgtcgacg
gaaggggatacatgtaagaacatcaaactcgctgagaccttggaaaaggtggcagagaaa
gggatgcaagcgttttaccaagatgatgttgctgaaaatcttgtaaatgatctgatgcat
gctggagggaacatgacgttggaagatttgagggactataaagttaacgtgaccgatgca
atggttgtaaatgatgttatggggtttaaactacaaggaatgtggcctccgtctagtgga
acggccggttttgcaatggttatgaatatactggagcaatacacagatatagatggtatt
gataagaatctttttctgcatcgagttatagaagccataaagtttatgcttgcagctcga
atggatcttggagatcctgcgtttgttgaggggatatctgaagttgtgaaaaatatgacc
tctaagagttgggcccaaaatattcaggaaaagatatccgatgacaagacttacccacca
gattattaccgcaacaaatacaaacagctcaaggacgaagggacgagccacttctgtgta
gtacgttcagtttcatgcaacattaacacatttcaggtctag

DBGET integrated database retrieval system