KEGG   Brassica napus (rape): 106407681Help
Entry
106407681         CDS       T04128                                 

Definition
(RefSeq) phosphoenolpyruvate carboxykinase (ATP)-like isoform X1
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00020  Citrate cycle (TCA cycle)
bna00620  Pyruvate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106407681
   00020 Citrate cycle (TCA cycle)
    106407681
   00620 Pyruvate metabolism
    106407681
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106407681
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     106407681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-GeneID: 106407681
NCBI-ProteinID: XP_013704004
AA seq 665 aa AA seqDB search
MSAGNGNANGDGGFSFPKGPAIPKITTGAKRDNEICHDDSGPTVKATTLDELHSLQKKRS
APTTPINQSGAAFSEEERQKIQLQSISASLASLTRESGPKVVRGDPAEKKADGSTTPAYA
HGQHPSIFSPALGAVSDSSLKFTHVLYNLSPAELYEQAIKYEKGSFITSNGALATLSGAK
TGRAPRDKRVVRDATTEDELWWGKGSPNIEMDEHTFTVNRERAVDYLNSLEKVFVNDQFL
NWDPENRIKVRIVSARAYHSLFMHNMCIRPTPEELESFGTPDFTIYNAGQFPCNRYTHYM
TSSTSVDLNLSRREMVILGTQYAGEMKKGLFSVMHYLMPKRRILSLHSGCNMGKDGDVAL
FFGLSGTGKTTLSTDHNRYLIGDDEHCWTETGVSNIEGGCYAKCVDLSREKEPDIWNAIK
FGTVLENVVFDEHTREVDYSDKSVTENTRAAYPIEFIPNAKIPCVGPHPKNVILLACDAF
GVLPPVSKLNLAQTMYHFISGYTALVAGTEDGIKEPTATFSACFGAAFIMLHPTKYAAML
AEKMKRQGATGWLVNTGWSGGSYGVGNRIKLAYTRKIIDAIHSGSLLKANYKKTDIFGFE
IPTEIEGIPSEILDPVNSWSDKNAHKETLLKLGGLFKKNFETFANHKIGVDGKLTEEILS
AGPIF
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccggtaatggaaacgcaaacggtgacggagggtttagcttcccgaaaggacca
gctataccaaagataacgacgggagctaaaagggataacgaaatatgccacgatgacagt
ggtccgactgtgaaggcgacgacgctcgatgagcttcactctttacagaagaagcgttct
gctcccaccactcctattaaccaaagcggcgctgccttctccgaggaggaacgccagaag
attcagcttcagtctatcagtgcatcgttggcgtcgctgacgagagaatctggacccaaa
gtggtgagaggagacccggcggagaagaaggccgacggttccactactccggcgtacgca
cacggccagcatccttccatcttctctccggcgttgggagctgtaagtgatagctccttg
aagttcacccacgtcctctacaacctttctcccgcagagctctacgagcaagctatcaag
tacgagaaaggttcgttcatcacttccaatggagctttggctacgctttccggtgctaaa
actggtcgtgctccgagggataagcgtgtcgttagagatgcgactacagaggacgagctt
tggtggggaaagggctcgccgaatatcgaaatggatgaacatacattcacggtgaacaga
gaaagagccgttgattacttgaactccttggagaaggtgtttgtgaatgatcagttcttg
aactgggacccggagaacagaatcaaagtcaggattgtctcagctagagcttaccattca
ctcttcatgcacaacatgtgtatccggccaacaccggaggagcttgagagcttcggtact
ccggacttcactatatacaacgctggacagtttccgtgtaaccgttacactcactacatg
acgtcatccactagcgtagacttgaatcttagcaggagggaaatggttatactcggcact
caatatgctggtgagatgaagaagggacttttcagtgtgatgcattaccttatgcctaag
cgtcggattctctcccttcactctggttgcaatatgggaaaagatggagatgttgctctc
ttctttggactttcaggtaccgggaagacgacgctgtctactgatcacaacaggtatttg
ataggagatgatgagcattgttggactgagactggtgtttcgaacattgagggtggatgc
tatgctaagtgcgttgatctttcgagggagaaggagcctgatatttggaacgccatcaag
tttggaacagttttggaaaatgttgtgtttgatgaacataccagagaagttgattactct
gataaatccgttacagagaacacacgtgctgcataccctattgagttcattccaaacgcg
aaaataccttgcgttggtccacacccgaaaaacgtgattcttctggcatgtgacgccttt
ggtgttctcccgcctgtgagcaagcttaatcttgcacaaaccatgtaccacttcatcagt
ggttacactgctctggttgcgggcacggaggacggcataaaggagccaacagcaacattc
tcagcatgctttggtgcagctttcataatgttgcatccaacaaagtatgcggctatgtta
gccgagaagatgaagaggcaaggcgctactggatggctcgttaacactggttggtccggt
ggcagctacggtgttggaaacaggatcaagctggcgtatactaggaagatcatcgatgca
atccattcagggagcttgttgaaggctaactacaagaaaacagatatttttgggtttgaa
atcccaactgagattgaagggataccttcagagatcctggatcctgtcaactcgtggtct
gataagaacgcacataaggaaactctgttgaagctgggaggtttgttcaagaagaacttt
gagacgtttgctaatcataagattggtgtggatggtaagcttacggaggagattctctct
gctggtcctatcttttaa

DBGET integrated database retrieval system