KEGG   Brassica napus (rape): 106409935Help
Entry
106409935         CDS       T04128                                 

Definition
(RefSeq) coatomer subunit alpha-2-like
  KO
K05236  coatomer subunit alpha
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106409935
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106409935
Membrane trafficking [BR:bna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    106409935
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106409935
  Exosomal proteins of bladder cancer cells
   106409935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Coatomer_WDAD COPI_C WD40 ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 106409935
NCBI-ProteinID: XP_013705927
AA seq 1039 aa AA seqDB search
MFTKFQTKSNRVKGLTFHPKRPWILASLHSGVIQLWDYRMGTLIDRFYEHEGPVRGVHFH
NSQPLFVSGGDDYKIKVWNHKTHRCLFTLLGHLDYIRTVQFHHENPWIVSASDDQTIRIW
NWQSRTCISVLTGHNHYVMCASFHPKEDLVVSASLDQTVRVWDIGSLKKKTVSPADDLMR
FTQMNSDLFGGVDAIVKYVLEGHDRGVNWASFHPTLPLIVSGADDRQVKLWRMNETKAWE
VDTLRGHMNNVSSVMFHAKQDIIVSNSEDKSIRVWDATKRTGIQTFRREHDRFWILAVHP
EINLLAAGHDNGMIVFKLERERPAFAVSGDSLFYAKDRFLRYYEYSTQKDAQVIPIRRPG
TPSLNQSPRTLSYSPTENAVLICSDLDGGSYELYIIPKDSVGRSDVVQDAKRGTGGSAVF
IARNRFAVLEKSTSQVLVKNLKNEVVKKSSLPIPTDAIFYAGTGNLLCRSEDKVVIFDLQ
QRLVLGELQTPFVRYVVWSNDMENVALLSKHTIIIASKKLVLQCTLHETIRVKSGAWDDN
GVFIYTTLNHIKYCLPNGDSGIIRTLDVPIYITKVSGNTIFCLDRDGKNRAITINATEYI
FKLALLRKRYDHVMSMIKNSQLCGQAMIAYLQQKGFPEVALHFVEDERVRFNLALESGNI
SIAVASATEINEKEQWYRLGVEALRQGNAGIVEFAYQQTKNFERLSFLYLITGKLDKLSK
LMKIAEVKNNVMGQFHNALYLGDVKERVKILENAGHLPLAYITASVHGLTDTAERLATEL
GDNVPSLPEGKVVPLAIERGWSESNSPNVRGPPALVYDFSQQEEKLKSGYKATTSGKDEK
LTEALRLFLSILHTIPLVVVESRSEVDEVKELVSIAKEYVLGLKMELKRRQKKDDPVRQQ
ELAAYFTHCNLQLPHLRLALLNAMTVCYKAKNLATAYNFAKRLLETNPLESHARAARQIV
QAAERNMTDATELNYDFRNPFVICGSTYVPIYRGQKDVSCPYCTTRFVPSQEGNICGVCD
LAVIGAAASGLICSPSQVR
NT seq 3120 nt NT seq  +upstreamnt  +downstreamnt
atgttcacgaagttccagacgaagagtaacagagttaagggcctcaccttccaccctaag
cgaccatggatcctcgccagtttgcacagtggtgtgatccagctctgggattatcgtatg
ggtactttgatcgatcggttctacgagcacgaaggtcctgttcgtggtgttcactttcac
aattctcagcctctattcgtctccggaggtgatgattacaagattaaagtttggaaccac
aaaacacacaggtgcctcttcacccttctcggccatctcgactatatccgcactgtccaa
tttcaccacgagaacccgtggattgtgagtgctagtgacgatcagactatccgcatttgg
aactggcagtcacggacttgtatctctgtgttgactggccacaatcattatgtcatgtgt
gcttctttccatcctaaagaagaccttgtcgtatcagcatctctggatcagactgtccgt
gtctgggatattggttctcttaagaagaagacagtatctcctgctgatgacctcatgcga
tttacgcagatgaactctgatctttttggtggtgttgacgctattgttaagtatgtcctc
gaaggtcatgatagaggagtaaactgggcttcttttcatcccactcttcctctcatcgtc
tctggtgcggatgaccgccaagtgaagctgtggcgtatgaatgaaactaaagcttgggag
gtggatacactgcgaggccacatgaataacgtttcatctgttatgttccatgcaaaacag
gacataattgtatccaactctgaggacaaaagtattcgtgtctgggatgctaccaagcga
actggaatccaaacatttcgccgggaacatgatcggttctggattcttgcagttcaccct
gagatcaatttactggcagcggggcatgacaatggtatgatcgtgttcaaacttgagaga
gaacgtcctgcatttgctgtgagtggtgattctctgttctatgccaaagatagatttttg
aggtactacgaatattcaactcagaaagatgcccaagttatccctatacggcgtcctggt
acaccaagcttgaatcaaagtccaaggactctatcatacagtccgacagaaaatgcagtt
ctgatctgctcagatctggatggtggttcgtacgagttgtacatcataccgaaagatagt
gttggcaggagtgacgttgtgcaagatgcaaagagggggacaggtggttctgctgtattc
attgcccgtaaccgctttgctgttcttgagaaaagcaccagccaggtactagtcaagaat
ctcaagaatgaggtggttaagaagagttctctgcctatacccacagatgctatcttttat
gctgggactggaaatttgctttgtagatcagaggataaagtggtaatatttgaccttcag
caaaggcttgttcttggtgaacttcagacaccgtttgttaggtatgttgtttggtccaat
gatatggagaatgttgctttgctcagcaaacacactatcattattgcgagcaaaaaactt
gtcctccagtgcacacttcatgagacaatacgtgtgaagagtggagcttgggatgacaat
ggtgtcttcatctacacaactttgaaccatatcaagtactgtcttcctaatggagatagt
gggataatccggaccctggatgtccctatctatatcaccaaggtgtcaggaaacacaatc
ttttgcttggaccgggatgggaaaaacagggcaatcaccatcaatgcaactgaatacatt
ttcaagcttgcactgctgagaaagagatatgatcatgtcatgagcatgataaagaactcc
cagctctgcggacaggctatgattgcttacctgcagcagaaaggattccctgaagttgcc
ctccattttgttgaagacgagagagtccggttcaacctggctcttgaaagtggcaacatc
agcatcgctgttgcatccgctacagagattaatgagaaagagcagtggtatagacttggg
gtggaggctcttcgccaaggtaatgctggaattgttgaatttgcgtaccagcagacgaag
aactttgagaggttatcttttctttacctcattactggtaagttggacaagctttcaaag
ttgatgaagattgcagaagtgaagaacaatgtaatgggtcagtttcacaatgctctctac
ctaggagatgttaaagagcgtgtcaagatacttgagaatgctggtcatttgcctctcgct
tatatcactgcttcggttcatggtttaacggacactgctgagcgacttgcgactgagcta
ggagacaacgtgccctcgttacctgaggggaaagtggttccacttgccattgaacgtgga
tggagcgagtcaaacagtcccaacgtccgtggcccaccagctcttgtttatgatttctct
cagcaagaagagaagctcaaatctggctacaaagccacaacaagtgggaaagatgagaaa
ttgactgaggctctccggctcttcctctctatcctccacaccatccctctagtggtggtc
gagtcaagaagtgaagtagatgaggttaaggaactggtcagtatcgctaaagaatatgtc
ctcggtcttaaaatggagctcaagagaagacagaagaaagatgatccagtgaggcagcag
gagcttgctgcttacttcactcactgcaacctccaactacctcacttacgactcgcgctg
ttaaatgcaatgaccgtctgctacaaggccaagaatctcgccactgcctataacttcgct
aaaagattgctggaaaccaacccattggagagccatgccagagcggctagacaaatcgtt
caagccgctgaacgcaatatgactgatgcaaccgagctcaactacgacttcagaaacccg
tttgtgatatgcgggtcaacctatgtcccaatctacagaggtcagaaagacgtttcctgt
ccgtactgcaccaccaggtttgtaccgagccaggaaggaaacatatgcggggtctgtgat
cttgcagtcattggcgcagccgcatctggtttgatatgctcgccgtctcaggtccggtga

DBGET integrated database retrieval system