KEGG   Brassica napus (rape): 106410343Help
Entry
106410343         CDS       T04128                                 

Definition
(RefSeq) autophagy-related protein 16-like
  KO
K17890  autophagy-related protein 16-1
Organism
bna  Brassica napus (rape)
Pathway
bna04136  Autophagy - other
Brite
KEGG Orthology (KO) [BR:bna00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04136 Autophagy - other
    106410343
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    106410343
   03029 Mitochondrial biogenesis [BR:bna03029]
    106410343
Membrane trafficking [BR:bna04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    106410343
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    106410343
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    106410343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 Nup160 Ge1_WD40 eIF2A Cytochrom_D1
Motif
Other DBs
NCBI-GeneID: 106410343
NCBI-ProteinID: XP_013706289
AA seq 509 aa AA seqDB search
MSQEEKAMEAIKDALRALRQRHLLEEGAHGPAISALSKPMISQGSEWKEKTEKLEIELQQ
CYKAQSRLSEQLVIEVAESRTSKSSLQDKELLILGLDKDLSQTREECTRLQQELEEKTKT
LDLLITENKEVRSQLEVMTNRAQKAESENKMLIDRWMLQKMQDAERLNEANALYEEMLAK
LKANGLENLARQQVDGIVRRNEDGTDHFVESTIPSTCGHRIHAHEGGCGSILFEYSSRTL
FTGGQAGPVKMWDTNSGSLIKSLNGSLGNILDLAITHDNKSLIAASSSNNLFVWDVNSGR
VRHTLTGHTDKVCAVDVSKFSSRHVVSAAYDRTIKLWDLQKGYCTNTVLFTSNCNAICLS
IDGLTVFSGHMDGNLRLWDIQTAKLLSEVAGHSSAVTSVSLSRNGNMILTSGRDNVHNVF
DTRTLEICGTLRASGNRLASNWSRSCISPDDEYVAAGSSDGTVHVWSISKGSIVSTLKEQ
TSPILCCSWSGIGKPLASADKNGYVCTWT
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaggaggagaaagcaatggaagccataaaagacgctttgagagctttgcggcag
cgccatcttctcgaagaaggagctcatggccccgccatttctgcgctctctaaacctatg
atttctcagggatctgaatggaaggagaaaacagaaaagctggagatagagctacagcaa
tgttacaaagcgcaatcccgattgtctgaacaactcgtgatagaagtagctgaatccaga
acttcaaagtcttctttacaagacaaggagttgttgattcttggcctcgacaaggactta
tcccaaacaagggaggagtgtacacggttacaacaagagttagaggaaaagaccaagacg
cttgatttacttattactgaaaacaaggaagtcagatctcagctggaggtgatgactaac
agagctcaaaaagcagagtctgagaacaaaatgttaattgatcggtggatgttacagaag
atgcaggatgcggaacgtcttaatgaggcaaatgctctctatgaagaaatgctagctaag
cttaaggccaatggtttggaaaatcttgctaggcagcaagttgatggaattgtccgacgc
aatgaagatggaactgatcattttgttgagtctaccatcccgtcaacatgtggccaccgt
atccatgctcacgaaggtggctgtggttcgatactctttgaatacagctctcgtactctg
tttaccggtgggcaagccggaccagtaaaaatgtgggacaccaatagtgggtctctaatc
aaaagcttaaacggttcccttgggaatatacttgatctagccataacccacgacaataag
tccctgatcgcagcaagcagctctaacaatttgtttgtgtgggacgttaactctggtagg
gtacgtcatactctcacaggccacacagataaagtatgtgctgtggatgtgagcaagttc
tccagccgacatgttgtcagtgcagcttatgaccgtactattaaactctgggatttgcag
aaaggttactgtacaaacacagtgctctttaccagtaactgcaatgcgatctgcctaagc
atagacgggcttacggtattctcaggccacatggatgggaatcttaggttgtgggatatt
caaactgcgaaacttctgtctgaagtagctgggcattcttctgctgtaacctctgtatca
ttgtcccggaatggaaatatgatcttgacgagcgggagagacaacgtacataatgtattc
gatacacggactttggaaatttgcgggacgttgagagcatcagggaacagattggcgtcg
aattggagccggtcgtgtataagtccagatgatgaatacgtggctgcgggatcttcggat
ggaacggtgcatgtctggtctatctccaaaggcagtatagtgagcactctcaaggagcaa
acatctcctatactgtgttgttcttggagtgggatcgggaaaccattggcatcggctgat
aaaaacgggtatgtctgtacttggacatga

DBGET integrated database retrieval system