KEGG   Brassica napus (rape): 106410387Help
Entry
106410387         CDS       T04128                                 

Definition
(RefSeq) fructose-bisphosphate aldolase 2, chloroplastic-like
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00030  Pentose phosphate pathway
bna00051  Fructose and mannose metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
bna01230  Biosynthesis of amino acids
Module
bna_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bna_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106410387
   00030 Pentose phosphate pathway
    106410387
   00051 Fructose and mannose metabolism
    106410387
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    106410387
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     106410387
Membrane trafficking [BR:bna04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    106410387
Chromosome and associated proteins [BR:bna03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    106410387
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106410387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 106410387
NCBI-ProteinID: XP_013706335
AA seq 398 aa AA seqDB search
MASTSLLKASPVLDKSEWVKGQSVLFRQPSSAAVVLRNRATSITVRAASSYADELVKTAK
TIASPGRGILAMDESNATCGKRLDSIGLENTEANRQAYRTLLVSAPGLGQYISGAILFEE
TLYQSTTEGKKMVDVLVEQNIVPGIKVDKGLVPLVGSNNESWCQGLDGLSSRTAAYYQHG
ARFAKWRTVVSIPNGPSALAVKEAAWGLARYAAISQDSGLVPIVEPEILLDGEHDIDRTY
EVAEKVWAEVFFYLAQNNVMFEGILLKPSMVTPGAESKDRATPEQVASYTLKLLRNRIPP
AVPGIMFLSGGQSELEATLNLNAMNQAPNPWHVSFSYARALQNTCLKTWGGRAENVNAAQ
TTLLTRAKANSLAQLGKYTGEGESEEAKEGMFVKGYTY
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaacctcactcctcaaggcttctccagtgttggacaaatctgagtgggtcaag
ggccaaagtgttctcttccgtcagccttcctccgccgcagtcgtcctacgcaaccgtgcc
acctccattaccgtccgcgccgcttcttcctacgccgatgagctcgttaagacagcgaaa
acaattgcgtctcctggacgaggaatcttggcgatggacgagtcgaacgcgacatgcggg
aagcgtttggactcgatagggctagagaacactgaggcaaaccgtcaagcataccggacg
ctgcttgtctctgcaccaggtctcggacagtacatctccggtgcaatcctgttcgaggag
actctgtatcagtctaccaccgaaggcaagaaaatggtcgacgtcctcgtcgagcaaaac
attgttcccggtatcaaagttgacaagggtctggtgccacttgttggatctaacaatgag
tcatggtgccaaggactcgacggtctatcctctcggaccgctgcttactaccaacatggt
gctcgtttcgccaaatggcgtactgtggtgagcattcccaacggtccgtctgctctagct
gtgaaagaagctgcttggggccttgctcgatacgctgccatttcacaagacagtggattg
gttccaatagtggagccagagatattgttggacggagaacacgacattgacaggacttac
gaagtagcagagaaggtttgggctgaggttttcttttaccttgctcagaacaatgtcatg
tttgaaggtatcctcctgaagccgagcatggtgactccaggagccgagtctaaagacaga
gctactcctgaacaagttgcctcctacacccttaagctcctccgcaacagaatccctcct
gccgtccccggaatcatgttcttgtcgggaggacagtctgagttggaggcaacgttgaac
ctgaacgccatgaaccaggcaccaaacccgtggcacgtgtccttctcctacgcacgtgct
cttcagaacacttgcctgaaaacctggggaggcagagctgagaacgtgaacgcagctcag
accactctcttgactcgagccaaggccaattcgttggctcagctcggcaaatacaccgga
gaaggtgagtctgaagaggctaaggagggtatgttcgtcaaaggctacacctactga

DBGET integrated database retrieval system