KEGG   Brassica napus (rape): 106412129Help
Entry
106412129         CDS       T04128                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 51
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106412129
   03009 Ribosome biogenesis [BR:bna03009]
    106412129
Enzymes [BR:bna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106412129
Spliceosome [BR:bna03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    106412129
Ribosome biogenesis [BR:bna03009]
 Eukaryotic type
  90S particles
   Helicases
    106412129
  Pre-60S particles
    106412129
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_22
Motif
Other DBs
NCBI-GeneID: 106412129
NCBI-ProteinID: XP_013708475
AA seq 569 aa AA seqDB search
MVELKKEKASEELKKRVRKRNRGKKNDLQKVEDEEEETHNVEENVDGIQNKMEKKVKKVK
KLQGRVKTDEDEEEEKKMVVVGKGIMTNETFESLDLSEQTFEAIKVMGFEHMTQIQAGSI
PPLLEGKDVLGAARTGSGKTLAFLIPAVELLFKERFSPRNGTGVIVICPTRELAIQTKNV
AEELLKHHSLTVSMVIGGNNRRTEAQRIANGSNLLIATPGRLLDHLQHTKGFIYKHLKCL
VIDEADRILEENFEEDMNKILKILPKTRQTALFSATQTSKVQDLARVSLTSPVLVDVDDG
RRKVTNEGLEQGYCVVPSEKRLLLLISFLKKNLNKKIMVFFSTCKSVQFHAEIMKLINVE
SCDIHGGLDQNRRTKTFFDFMKAEKGILLCTDVAARGLDIPAVDWIIQYDPPDKPTEYIH
RVGRTARGEGAKGKALLVLIPEELQFIRYLKAAKVPVKELEFNEKKLLNVRSALEKYVAN
DYNLNKTAKDAYRAYIAAYNSHSLKDIFNVHRLDLQAVALSFCFSSPPKVNLNIESGAGK
VRKARNQQARNGFSPYSPYGKVKSTPKEA
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggttgagctcaagaaagagaaagccagtgaagagctcaagaagagagtcagaaagaga
aaccgtgggaagaagaacgacctgcaaaaggtggaagacgaagaagaagaaacccacaat
gtagaggaaaacgtagatggaatccagaacaagatggagaaaaaggttaagaaagtgaag
aagctgcaaggaagagtcaaaactgatgaagatgaagaagaagagaagaagatggtggtt
gttgggaaagggataatgactaatgagacttttgaatcccttgacttatctgagcagact
ttcgaagctatcaaggtcatgggttttgagcatatgactcaaattcaagctggatcaatt
cctccccttttggaggggaaagatgttcttggtgctgctaggactggttctggtaaaaca
cttgcttttctcatacctgctgttgagttgctctttaaagagcgtttctctcctcgcaac
gggactggtgtcatcgttatttgccccacaagggagcttgctattcagacaaaaaatgta
gcggaggagctgctcaagcatcactcgctgacggtcagcatggttattggtggcaataac
agaaggacagaagcacaacgtattgcaaatggttctaatttgttgattgcaacccctggg
cgtcttcttgaccatcttcaacacacaaagggtttcatttataaacacctcaagtgcctt
gtgatcgatgaagctgacagaatcctggaagaaaattttgaggaagacatgaataagatt
ctaaagattttaccaaagactaggcaaaccgcactattctctgccactcaaacctccaag
gttcaagatcttgctcgagtgtcactgacgtctcctgttctcgttgatgtcgatgatggt
agacgcaaggtgacaaatgaaggattggagcaaggctactgtgttgttccgagcgagaaa
agacttctcctcctaatatcttttttgaagaagaatctaaacaagaaaataatggtgttc
ttctcgacgtgcaagtcggtacagttccatgccgagatcatgaaactaatcaacgtggaa
agctgtgacatccatggaggactggatcagaaccgaaggactaaaacctttttcgacttt
atgaaagcagagaaaggtattctgttgtgtactgatgtggctgctcgtggtcttgacatt
cctgcggtggactggattatacagtatgatcctccagacaagcccacggagtatatccat
agggttggccgaacagctcgtggagaaggagcaaagggaaaggcattacttgtcttgata
cctgaagagcttcagtttattagataccttaaggctgcaaaagtacctgtaaaagagctt
gagttcaatgaaaagaagcttttgaatgttagatccgccctggagaagtatgtagccaat
gactataatctgaacaagacagccaaggacgcgtacagggcttacatcgcagcatacaat
tcacattctctgaaggacatctttaatgttcaccggctcgatctccaggcggttgctcta
tcgttctgtttctcatcgccgccaaaagtgaatctgaacatagaaagtggagctgggaag
gtgaggaaggctaggaatcagcaagcgcgtaatggcttctctccttacagtccctatggc
aaagtcaagtccacacccaaagaggcatga

DBGET integrated database retrieval system