KEGG   Brassica napus (rape): 106413371Help
Entry
106413371         CDS       T04128                                 

Definition
(RefSeq) xyloglucan 6-xylosyltransferase 1-like
  KO
K08238  xyloglucan 6-xylosyltransferase [EC:2.4.2.39]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:bna01003]
    106413371
Enzymes [BR:bna01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.39  xyloglucan 6-xylosyltransferase
     106413371
Glycosyltransferases [BR:bna01003]
 Polysaccharide
  Structural polysaccharide
   106413371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_34 DUF273
Motif
Other DBs
NCBI-GeneID: 106413371
NCBI-ProteinID: XP_013709615
AA seq 184 aa AA seqDB search
MVYDQKNWIGLNTGSFLLRNSQWALDLLDAWAPMGPKGKIREEAGKVGDGLSPGHGEGEM
GGKVYLESGYYLHGYWGILVDRYEEMVENHKPGFGDHRWPLVTHFVGCKPCGKFGDYPVE
RCLRQMDRAFNFGDNQILQMYGFTHKSLGSRRVKPTRNQTDRPLDAKDEFGLLHPSFKAA
KLTT
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggtttacgaccagaagaattggattgggcttaataccggaagtttcttgcttcggaac
tcgcaatgggcccttgatttactcgacgcttgggctccaatgggcccgaaagggaaaatc
cgggaagaagcgggtaaagtcggcgatggtttatctcctggccacggagagggagaaatg
ggagggaaagtgtatctagagagtggttattacttgcatggttattgggggattttggtg
gaccggtacgaggagatggtcgagaatcataaaccgggttttggagaccatcggtggccg
cttgttactcatttcgtcgggtgtaaaccgtgcgggaaatttggtgattatccggtggaa
aggtgtctacgtcagatggacagagcgtttaattttggggacaatcagatacttcagatg
tatgggttcactcataagtcgttagggagtcggcgcgtgaaaccaacgcgcaaccagacg
gataggccgcttgatgccaaggacgagtttgggctgcttcatccgtcgtttaaagcggcg
aagctcacgacgtga

DBGET integrated database retrieval system