KEGG   Brassica napus (rape): 106415092Help
Entry
106415092         CDS       T04128                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 1
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
bna  Brassica napus (rape)
Pathway
bna00260  Glycine, serine and threonine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106415092
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     106415092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_3 Cys_Met_Meta_PP Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 106415092
NCBI-ProteinID: XP_013711164
AA seq 358 aa AA seqDB search
MVMRIVDLRSDTVTRPTDAMREAMASAEVDDDVLGYDPTARRLEEEMAKMMGKEAALFVP
SGTMGNLICVMVHCDVRGSEVILGDTCHIHVYENGGISTIGGVHPKTIRNEEDGTMDLVA
IEAAIRDPKGSTLYPSTRLICLENTHANSGGRCLSAEYTDRVGEIAKRHGLKLHVDGARI
FNASIALDVPVHRLVKAADSVSVCLSKGLGAPIGSVIVGSQSFIEKAKTLRKTLGGGMRQ
IGVLCAAALVALQENLPKLQSDHKKTKLLAEGLNKMKGIRVNVAAMETNMIFMDMEDGSK
LTAEKLRKSLTEHGILVIPENSTRIRMVLHHQITTSDVHYTLSCLQQAVQTIHEPCQN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtgatgagaatcgtggatctacgttcagacaccgtgacaagacccactgatgcaatg
cgcgaagcaatggctagtgcagaggtggacgatgacgtcctcggctacgacccaacggct
cgacgtcttgaagaggagatggctaagatgatggggaaagaagcggctctgttcgtgcca
tctggtacgatggggaacctgatatgcgttatggttcactgcgacgtaagaggcagcgag
gtgattcttggtgacacttgtcacatccatgtgtacgagaacggagggatatcgacaata
ggtggagtgcatcccaagacaatcaggaatgaagaagatgggacaatggacttggtggct
atagaagcagctattagagatcctaaaggaagcacgttgtatccatcaacaaggttgatt
tgtttggagaacacacatgccaactctggtggaagatgtttgagtgcggagtacactgat
agagttggagagattgccaagagacatggattgaagcttcatgtcgatggagctcgcatt
tttaatgcttccattgcactagatgttccagtccataggcttgtgaaggctgctgactct
gtttcggtgtgtctctctaaaggtcttggagctccgataggatctgtaatcgttggttca
cagagtttcatagaaaaggccaaaacgttaaggaaaacattaggtggaggaatgcgacag
ataggtgtcctgtgtgcagccgctttggtcgcactccaagagaatctcccaaagctacaa
tctgaccacaagaagacaaagttgttagccgaagggttgaacaaaatgaaagggattaga
gtgaacgttgcagccatggagaccaacatgatattcatggatatggaggatggatcaaaa
ctgaccgctgaaaaactccgcaagagtctaacggagcatggcattctcgtcatccctgaa
aactctacccgaatcagaatggttctacaccaccagataacaacaagtgatgtgcattac
acattgtcttgcttacaacaagcagtgcagacgattcatgaaccatgccaaaactaa

DBGET integrated database retrieval system