KEGG   Brassica napus (rape): 106416383Help
Entry
106416383         CDS       T04128                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1 isoform X1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00562  Inositol phosphate metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106416383
   00562 Inositol phosphate metabolism
    106416383
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     106416383
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     106416383
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 106416383
NCBI-ProteinID: XP_013712709
UniProt: A0A078GC45
AA seq 478 aa AA seqDB search
MAMKSVWIILLCLFVIAEADQGFDVRHHLSTVTRYSASKEVSQNLIEGSNVPSECTPIHL
NLVARHGTRSPTKKRLRELENLSGRLKELVRDAEASDKVPGWLGKWISPWKGKVKGGELI
RQGEEELYQLGIRVRERFPTLFEEDYHPDVYTIRATQIPRASASAVAFGMGFFSEKGDLG
PGSNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKGPAVDMLKEPVLDKITASVAKRHG
LNFTKQDVSSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWADDLEVFILKGYGNSLNY
RMGVPLLEDVFYSMEEAIKAREDKLPPGSYEKARLRFAHAETIVPFSCLLGLFLDGSEYE
KIQKEKPLELPPQPPKTRDFRGSTMAPFGGNNMLVLYSCPAASSPKYFVQVLHNEHPIAL
PGCDGKDFCPLEDFKAKVVTPHLKHAFDNLCNANLDDPKQEHQSLWSWLLGSSQKTEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgaagagtgtttggatcatactgctctgtttattcgttatcgcagaggcagat
caaggcttcgatgttcgtcatcacttatccaccgtcaccagatactcagcttcaaaagaa
gtctctcaaaatctgattgaagggtcaaatgtccccagtgagtgtacacctatccacctt
aaccttgtggctaggcatggaactcgttctccaaccaagaaaaggttacgggaactagaa
aatttatccggtaggctaaaggaactggtaagagacgcagaagcttcagataaagttcct
ggatggttagggaaatggatatctccatggaaaggcaaagtgaaaggcggtgagctgatc
aggcaaggagaggaggagctgtaccagcttgggatcagggttagggaacggttccccact
ttgttcgaagaggattatcaccctgatgtttataccattagagctacacagattcctcgg
gcatctgcaagtgctgtggcgtttggaatgggatttttcagtgagaaaggagacttggga
cctgggagtaatagagcgtttgctgtcactagtgagaaccgtgctagtgataccaagcta
agattctttgaatgttgtcaaaactacaagagctataggaaagctaaagggcctgctgtg
gatatgctcaaggagcctgttcttgataagatcacagcttccgtagcaaagagacatggt
ttaaatttcactaaacaagacgtttcttctctctggtttctatgcaagcaggaagcatca
ttgcttaatgtaactaatcaaagttgtgaacttttcactccatctgaggttgctttgctg
gaatgggcagatgacttggaagtgtttattctcaaaggttatggaaactccttgaactac
agaatgggagttccgttgctagaagatgttttttattcgatggaagaagctatcaaggct
cgagaagacaagctcccacctggaagctacgaaaaagcaagactgaggtttgcacacgct
gagacaatagttcccttctcttgtcttcttggacttttccttgatggatctgagtatgag
aagatacagaaggagaaaccactggaactccctccacagcctcctaagaccagggacttt
agaggcagcaccatggctccttttggtgggaacaacatgcttgtcctctacagttgtcct
gcagcttcctctcccaagtactttgttcaggttctgcacaacgagcatcctattgcactt
ccaggttgtgatggaaaagacttctgtcctcttgaagatttcaaggccaaagtggtgact
cctcatctcaagcatgcttttgacaacctctgcaatgctaatttagacgaccctaaacag
gagcatcaatctctgtggagttggctgttggggtcaagccaaaaaaccgagctctaa

DBGET integrated database retrieval system