KEGG   Brassica napus (rape): 106419257Help
Entry
106419257         CDS       T04128                                 

Definition
(RefSeq) succinate--CoA ligase [ADP-forming] subunit alpha-1, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
bna  Brassica napus (rape)
Pathway
bna00020  Citrate cycle (TCA cycle)
bna00640  Propanoate metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106419257
   00640 Propanoate metabolism
    106419257
Enzymes [BR:bna01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     106419257
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     106419257
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 SseB
Motif
Other DBs
NCBI-GeneID: 106419257
NCBI-ProteinID: XP_013715470
AA seq 347 aa AA seqDB search
MSRQVTRLLGSLSSKARRCSIGFSEVSPSCQSLTSLTQSRSFASDPPPPAAVFVDKNTRV
MCQGITGKNGTFHTEQAIEYGTKMVAGVTPKKGGTEHLGLPVFNSVAEAKAETKANASVI
YVPAPFAAAAIMEGIQAELDLVVCITEGIPQHDMVRVKHALNSQSKTRLIGPNCPGIIKP
GECKIGIMPGYIHKPGKIGIVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVD
CLEKFFVDPQTEGIVLIGEIGGTAEEDAAALIKASGTEKPVVAFIAGLTAPPGRRMGHAG
AIVSGGKGTAQDKIKSLNDAGVKVVESPAKIGAAMYDLFKERGLLKE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtctagacaagtcacaaggcttctcggatctctctcatcaaaagctcgccgctgctcc
atcggcttctcggaggtttctccctcatgccagtctctcacttcgttgacccaatctcgc
tccttcgcgtcggatcctccccctccagccgccgtcttcgtcgacaaaaacaccagagtc
atgtgccaaggcatcaccggaaagaacgggactttccacaccgagcaagccattgagtac
ggcaccaaaatggtggcaggagtgacgccaaagaagggtggaacagagcacttaggtctc
cctgttttcaactctgttgctgaagcaaaagctgagaccaaagccaatgcttctgtgatt
tacgttcctgcgcctttcgctgctgctgccattatggagggtattcaagctgagctggat
cttgttgtctgcattaccgaaggaatccctcaacatgacatggtacgtgtaaagcatgct
cttaatagtcagtcaaaaactaggctgattggtccaaactgccctgggattatcaagcct
ggtgaatgcaagattggtattatgccgggttacatccacaagcctggcaagattgggatt
gtctctcgctctggaacattgacatatgaagctgttttccaaacaactgcagtgggtcta
ggccaatctacttgtgtaggaattggtggggatccttttaacggtaccaactttgtcgac
tgcttggagaagttctttgttgatcctcaaacagaaggtatcgttctcattggagaaatc
ggaggcactgcggaagaagatgctgcagcgttgataaaggcaagtggtactgagaagcct
gttgttgcttttattgctggactcactgcaccacctggtcgacgaatggggcatgcagga
gctattgtttcgggtggcaaaggaacggctcaggacaagattaagagcctaaatgatgct
ggagtgaaggttgttgagtctcctgctaaaataggagctgccatgtatgatctctttaaa
gaaagaggtcttctgaaggagtga

DBGET integrated database retrieval system