KEGG   Brassica napus (rape): 106420427Help
Entry
106420427         CDS       T04128                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK4
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106420427
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106420427
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106420427
Protein kinases [BR:bna01001]
 Serine/threonine kinases: Other
  Wnk family
   106420427
Protein phosphatases and associated proteins [BR:bna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106420427
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pneumo_M2
Motif
Other DBs
NCBI-GeneID: 106420427
NCBI-ProteinID: XP_013716708
AA seq 561 aa AA seqDB search
MNMNQVSEYVETDPTGRYGRFAEVLGRGAMKTVYKAIDEMLGIEVAWSQVKLKEVLRSSV
DLQRLYSEVHLLSTLNHKSIIRFYTSWIDVHSHTLNFITELFTSGTLRQYKNKYLRIDIR
AIKSWARQILEGLVYLHGHDPPVIHRDLKCDNIFVNGHLGQVKIGDLGLARMLRDCHAAT
SVIGTPEFMAPELYEENYNELIDVYSFGMCFLEMITSEFPYSECNNPAQIYKKVVAGKLP
GAFYRVEDIEAQRFIGKCLVPASKRVSARELLQDPFLASDDSWMVYASGARNLKPFLNEN
EMDRLKLEDNETEELDSEDNKIYLKLPIANENGLAKNVSFCFDIVNDTSIDVATEMVKEL
EITEWDLVEIAKMIDGEISSLVPGWRSEEDDESLHDFHTPYHSSSSPSSSRASLSNYMAP
GRQDWLQDDFHDETYSQSSSNSGSYSNLNYISVDEHISSQPPAMNRTHNVTRFCPEESYH
LHSGQANMYAASSSSSNLRLASDNRVLTRNRSLVDVQGQLLHRSLVEEARKRRLIKTVGD
VENVGFQSPYAVSRKPRSSRR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacatgaatcaagtttcagagtatgtggaaaccgatccaactggtcgctatggacgt
tttgctgaagttcttggaaggggagctatgaaaacagtgtacaaagcaatcgacgagatg
ctggggatagaagtagcgtggagccaggtgaagctaaaagaggttctacgttcttctgtt
gatctacagaggctctactcagaggttcatcttctcagcactctaaaccacaaatctatc
attcgtttctacacttcctggatcgatgttcattcccatactctcaacttcatcaccgag
ttgttcacttctgggaccctccgacaatacaaaaacaagtacttgcggatagatattcga
gcaatcaagtcatgggctcggcagatcttggaagggcttgtttatctccacggccacgac
cctcctgtgatccatagagaccttaagtgtgataacatctttgttaatggccatcttggt
caagtcaaaataggcgatcttggtcttgcaagaatgctccgggactgccacgccgccact
agtgtcatcggcactcccgagttcatggctccagaactatacgaggagaactataatgaa
ctcattgacgtttattcctttggtatgtgctttttggagatgatcacctctgagttcccg
tatagcgaatgcaacaatccagcgcagatttacaagaaagttgtcgcgggaaagctacca
ggagcgttttacagagttgaagacatcgaggcacagagattcatcgggaaatgcctcgta
cctgcctcaaagagagtatcagcaagagagctattgcaagatccgtttctcgcgtctgac
gactcctggatggtgtacgctagtggtgctaggaatctgaagcccttcttgaacgagaat
gaaatggatagactgaagctggaagacaatgaaactgaggagctggactctgaagataac
aaaatctatctgaaactaccaatcgcaaatgaaaacggtctagcaaagaacgtgtccttc
tgctttgacatcgtgaatgatacttccatagatgttgcgactgagatggtgaaagaacta
gagatcacagaatgggatctggtagagattgctaaaatgattgatggagagatctcttct
ttggtccctggttggaggtccgaggaagatgatgaatctcttcatgattttcatactcct
tatcactcttcttcctctccttcatcctctcgagcttcactctctaactatatggctcca
ggccgtcaagattggctacaagatgattttcacgatgagacgtattctcagagttcttca
aattcagggtcttactccaacctcaactacatatctgtagatgagcacatctcctcccaa
cctcctgctatgaacagaactcacaacgtgacaaggttttgccctgaagaaagctatcat
ctccattcaggacaagccaacatgtatgcagcttcttctagttcaagtaacttgagactg
gcatcagacaaccgcgtgctcacgaggaaccgctcgcttgtagacgtgcagggacagctg
ctgcatcggtcgctggtggaagaggctagaaaaagaaggttgatcaaaactgttggagac
gttgagaacgttgggtttcagtcgccttatgctgtttccaggaagccacggagctcaagg
cgctaa

DBGET integrated database retrieval system