KEGG   Brassica napus (rape): 106421096Help
Entry
106421096         CDS       T04128                                 

Definition
(RefSeq) probable receptor-like protein kinase At1g33260
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106421096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH RIO1 Kinase-like Haspin_kinase Seadorna_VP7 PIP49_C Kdo
Motif
Other DBs
NCBI-GeneID: 106421096
NCBI-ProteinID: XP_013717396
AA seq 347 aa AA seqDB search
MSCFLTCVRFDDWTTDKKPKITGSVSVSGITCYTWDDVESLTSNFSRLIGSGGYSSIYLA
RLSGAKKAAFKVHVGSHRLYQVFRSELEILLRLQHPHIVKLLGYFDDSEETGALLLEYLP
QGNLQEKLNHNSKQVLPWRNRTALAFQVAQAMEHIHEKCSPQIVHGDIKSSNILLDKNLN
CKLCDFGSARVGFSSMVQPSTTMSSPRSKQVRMIGSPGYTDPHYLRTGIASKKMDMYGFG
VVVLELVSGKEAVSAEKGEMLVHTAAPLIQDICDLGANIAEEKVRQFLDPRLSKDSSLDI
EEVKTMLGVAAFCLRSPPSLRPSASQVVQTLVQKIPYLSFLGCGKEA
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtttcttaacttgtgtacgtttcgatgactggaccaccgacaagaaacccaag
atcactggatctgtctctgtctccggcataacatgttatacctgggacgatgtagagtct
ctcacctcaaatttctctagactcatcggttccggtggctatagtagtatctacttggct
cgtttgtctggcgccaaaaaagcggctttcaaggttcatgtgggtagccaccgtctttac
caggtgtttagatctgagctcgagatcttgcttcgtcttcaacatcctcacattgtcaag
cttctcggttacttcgacgattcagaagaaactggtgcgcttctattagagtaccttcct
caaggtaacctccaagagaagctcaatcacaacagcaaacaagtgttgccatggagaaac
cgtaccgccctagcgtttcaagttgcgcaagcgatggaacacattcatgaaaaatgtagc
cctcagattgtgcacggtgacatcaaatcctccaacatacttcttgacaaaaacctcaac
tgcaagctttgcgactttggatcagccagagtcgggttctcatctatggtccagccttct
acaaccatgtcgtcacctcgttccaagcaagtgaggatgatcgggtctccagggtacact
gatcctcattacttgagaacggggattgcttcgaagaaaatggacatgtatgggtttgga
gtggtggttcttgagttggtttctggtaaagaagcggttagtgctgagaaaggtgagatg
ctggtgcatacggcagctcccttgatacaagatatctgtgatttaggtgccaatattgca
gaagaaaaggtgagacagttcttggatccgaggttgtctaaggacagtagtcttgatata
gaagaggtaaagacaatgctcggtgtggctgctttctgtcttcgcagcccgccatctctc
agaccctcggcttctcaagttgtacaaactcttgtccagaagatcccgtatctgtctttc
ctcggttgtggaaaagaagcgtga

DBGET integrated database retrieval system