KEGG   Brassica napus (rape): 106421156Help
Entry
106421156         CDS       T04128                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: tripeptidyl-peptidase 2-like
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bna01002]
    106421156
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bna03110]
    106421156
Enzymes [BR:bna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     106421156
Peptidases and inhibitors [BR:bna01002]
 Serine peptidases
  Family S8: subtilisin family
   106421156
Chaperones and folding catalysts [BR:bna03110]
 Intramolecular chaperones
  Subtilisin family
   106421156
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8 TPPII Prp19
Motif
Other DBs
NCBI-GeneID: 106421156
NCBI-ProteinID: XP_022561574
AA seq 1383 aa AA seqDB search
MDLSLQLQIGGTFVXKGPSCSSYWASPSSSTSLSLPRDFISSSPFLHRRLNRRSCSRFRS
RGIRLRRSGSSAMPSSSSETLTASRVDCGGGGGGGGGVACAGADNASVANFKLNESTFLA
SLMPKKEIRADRFLEAHPDYDGRGVVIAIFDSGFDPSAAGLHVTSDGKPKVLDVIDCTGS
GDIDTSTVVKANEDGLIRGASGAPLVVNSSWKNPTGEWRVGCKLVYQLFTDDLTSRVKKE
RRKIWDEKNQEEIAKAVKILYDFDQKHSKVDDTKLKKTREDLQSRVDFLKKQADKYEDKG
PVIDAVVWHDGEVWRVALDTQSLEEDPDCGKLADFSPLTNYRIERKYGVFSRLDACSFVT
NVYDEGKVLSIVTDSSPHGTHVAGIATAHHPEEYLLNGVAPGAQIISCKIGDSRLGSMET
GTGLTRALIAALEHNCDLVNMSYGEATLLPDYGRFVDLVTEAVNKRRLVFVSSAGNNGPA
LTTVGAPGGTTSSIIGVGAYVSPAMAAGAHSVVEPPSEGLEYTWSSRGPTSDGDLGVCIS
APGGAVAPVPTWTLQRRMLMNGTSMSSPSACGAIALLLSAMKAEGIPVSPYSVRRALENT
STPVGDLPEDKLTTGQGLMQVDKAYEYLKQFKDCPCVFYQIKVNLSGKTTPTSRGIYLRE
ATTCRQSTEWTVQVDPKFHEGASNLKELVPFEECLELHSTDEGVVRVPDYLLLTHNGRSF
NVVVDPTNLGDGVHYFEVYGIDCKAPQRGPLFRIPVTIIIPKTVANRPPVISFQQMSFVS
GHIERRYMEVPLGATWAEATIRTSGFDTTRRFYIDTLQLCPLRRPIKWEDAATFASPSAK
SFAFPVVSGQTMELAVAQFWSSGLGSREPTIVDFEIEFHGIGINKEELILDGSEAPIKVE
AEALLASEKLVPVAVLNKIRVPYQPVDAQLKTLSTGRDRLLSGKQILALTLTYKFKLEDA
AEVKPYIPLLNNRIYDNKFESQFYMISDANKRVYAMGDVYPESSKLPKGEYKLQLYLRHE
NVQLLEKLKQLTVFIERNMGEIRLNLHSEPDGPVTGNGVFKSSVLMPGVKEAFYLGPPTK
DKLPKNTPQGSVLVGEISYGKLSFDDKEGKNPKDNPVSYPISFVVPPKKPDEDKKAVSST
NSCKSVSERLEQEVRDTKIKFLGNLKQETEEERSEWKKLCACLKSEYPSYTPLLAKILEG
LLSRSEGGDKISHHEEIIDAANEVVRSVDVDELARFLLDKSEPEDEEAENLKKKMEMTRD
QLAEALYQKGLAMARIENLKGEKEDEGSCQKDKFEENFKELTKWVDVKSSKFGTLTVLRE
KRLSRLGTALKVLDELIQNENETANKKLYELKLGLLEELGWSHLVTYEKQWMQVRFPTSL
PLF
NT seq 4152 nt NT seq  +upstreamnt  +downstreamnt
atggatctgagtctgcagctacagattggcggcacgttcgtcnaaaaaggcccctcgtgt
tcgtcttattgggcttctccttcttcctccacgtcactctctcttccacgcgattttatt
tcttcttctccgtttcttcatcgaagactcaatagaagaagctgctctcgctttcgctct
cgtggaattcgattaagacggagcggttcctcggcgatgcctagttcttcttctgagact
ctaacggcttctcgcgtcgactgtggcggcggaggtggaggtgggggcggcgtcgcttgc
gctggagctgataacgcttctgtagctaatttcaagctgaacgagtcaaccttccttgct
tctctcatgcctaagaaagaaatacgcgcggatcgcttccttgaagctcatcctgactac
gatggtcgcggcgtcgtcatcgccatctttgattctggttttgatccttctgctgctggc
ttgcatgtaacatctgatggaaagccaaaggttctagacgtcattgactgtactggaagt
ggggatatagatacttccacagtggtgaaagccaatgaagatggtctcattcgtggagca
tcaggggcacctttggttgtcaattcttcatggaaaaaccccactggagagtggcgtgta
ggttgcaagttggtttaccagctatttactgatgacttaacttctcgtgttaagaaagag
agaaggaaaatatgggatgaaaaaaatcaggaagaaattgcaaaggctgtaaagattctg
tatgatttcgatcagaagcatagcaaggtggatgatacgaaactgaagaagacacgtgag
gacctccaaagcagagttgatttcctaaagaaacaagctgataaatatgaagacaagggg
cctgttattgatgctgttgtgtggcatgatggagaagtatggagggttgcacttgatacg
cagagtcttgaagaagatccagattgcgggaaactagcagacttctcccctctgacaaat
taccgaattgagcggaagtacggcgtgtttagccgactagatgcttgctccttcgttact
aacgtgtatgatgagggaaaggtcctaagcattgtaaccgatagttctcctcatggcact
catgttgctgggatagctactgcacaccaccccgaggagtacttgttaaacggtgtggca
cctggtgcacagataatatcttgtaaaattggagactcgcggttagggtcaatggagacc
ggaactggcttgactcgggcattgatagctgccctggagcataattgtgatcttgtcaac
atgagctatggagaggcaacattacttccagactatggacgctttgttgatcttgttact
gaagctgtgaacaagagacgcctagtatttgtaagtagtgctggcaacaatggtccagca
ttgacaacagttggtgcacctggtggaacaacttccagtatcattggtgttggtgcatat
gtttctcctgcaatggcagctggtgcccattcggtggtggaacctcccagtgaggggctt
gagtacacttggtcaagccgggggccaacctctgatggggatcttggtgtctgcataagt
gcacctggtggggctgttgctcctgttcctacatggacgcttcaaagacgcatgctcatg
aatggaacatcgatgtcatctccttctgcctgtggagcaattgcgttacttttgagtgct
atgaaggctgagggcatcccagttagcccgtacagtgtaaggagggctcttgaaaacaca
tcaactccggtaggtgatctacctgaggataaactgactactggacaagggctaatgcaa
gttgataaggcatatgaatacttgaaacagtttaaggactgtccatgcgtattttatcag
ataaaggtcaatctctcgggaaaaacaactccgacatcacggggcatctacctgcgggag
gctactacttgcagacaatctacagagtggacggtacaagttgacccgaagttccatgaa
ggtgcaagtaatttaaaggaacttgtgccttttgaagaatgccttgagttgcactccaca
gatgaaggagttgtacgggttcctgattatctacttctcactcataacggacgtagcttc
aacgttgttgtggaccccacaaatcttggggatggtgtgcactactttgaagtttatggg
attgattgcaaagctccacagcgtggtcctcttttcagaatcccagtgacaataataatt
cccaagactgtggctaatcgacctccagttatttcatttcaacaaatgtctttcgtctca
ggccacattgaacgaagatatatggaggtaccacttggagcgacatgggctgaggctaca
atacgaacttcagggtttgatactacacggagattttatattgatacccttcagctttgc
ccattgcgaaggcctatcaagtgggaggacgcagcaactttcgcatctccctctgctaaa
agctttgcgtttcctgtggttagtggtcaaacgatggaactagctgtagctcagttctgg
tccagtggccttggaagtcgtgaaccaactatcgttgactttgagatcgaattccatgga
attggtatcaataaagaagaattgatacttgatggaagtgaagcaccaataaaagttgaa
gctgaagcactattggcatctgaaaaacttgttcccgtagctgttctgaacaagatacga
gttccatatcaacctgttgatgcacaactcaagactctatcaactgggcgcgatagacta
ctgtcgggcaaacagatactagcattgacattaacctacaagttcaaattagaagatgca
gctgaagtgaaaccttatatacccttattgaacaatcgcatatatgacaataaatttgag
tcccagttttatatgatctctgatgccaacaagcgtgtatatgcaatgggtgatgtttat
ccggagtcttctaaactccctaagggagaatataaacttcagctgtatctaaggcatgaa
aatgtgcagttgctggaaaagttgaagcagctcactgtgtttattgaaagaaatatgggg
gagattcggctgaacttacactctgaaccagatggtccagtcacaggaaatggtgttttt
aaatcctctgttctaatgccaggggtgaaggaagcgttttatctgggcccaccaacaaag
gataagctacccaagaatactccccaaggatctgtgttggtgggagaaatctcatatggg
aaattgtcatttgatgataaagaagggaagaatccaaaggataatcctgtatcttatccg
atttcatttgtggttccaccaaagaagcctgatgaagataagaaggccgtttcttctaca
aatagctgtaaatctgtatcagaacgcttggaacaagaggttcgtgacacaaagatcaaa
tttcttgggaacctgaaacaagaaacagaggaagagcgttcagagtggaaaaagttgtgt
gcatgtctcaagtctgaatacccaagctacactccgttgcttgctaagatcttggaaggt
ttgctatctcggtccgaaggtggggacaaaatcagccatcacgaagagattattgatgct
gcaaacgaagtagtacgcagtgttgacgtagacgagttagcaagattcttgctagacaaa
agtgaaccagaagatgaggaagcagagaatttaaagaaaaagatggagatgacccgtgac
cagctggcagaagcactataccagaaagggttagccatggcgagaatcgagaatttgaag
ggtgagaaggaagatgaaggaagttgccagaaggataagttcgaagagaatttcaaagaa
ctgacaaaatgggttgacgtgaaatcatctaagttcggtactctcaccgttctaagagag
aaacgcctctcacgacttgggaccgcattgaaggtacttgatgagttgatccaaaacgag
aacgagactgctaataagaaactttacgaactgaaactgggcttactggaggaattaggt
tggagccatttggttacgtatgagaagcagtggatgcaagttcgttttcctacaagctta
cctctcttttag

DBGET integrated database retrieval system