KEGG   Brassica napus (rape): 106424644Help
Entry
106424644         CDS       T04128                                 

Definition
(RefSeq) probable tRNA (guanine(26)-N(2))-dimethyltransferase 1
  KO
K00555  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase [EC:2.1.1.215 2.1.1.216]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bna03016]
    106424644
Enzymes [BR:bna01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.215  tRNA (guanine26-N2/guanine27-N2)-dimethyltransferase
     106424644
    2.1.1.216  tRNA (guanine26-N2)-dimethyltransferase
     106424644
Transfer RNA biogenesis [BR:bna03016]
 Eukaryotic type
  tRNA modification factors
   Methyltransferases
    106424644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRM Cons_hypoth95 Methyltransf_25 PrmA Methyltransf_31 ADH_zinc_N Met_10
Motif
Other DBs
NCBI-GeneID: 106424644
NCBI-ProteinID: XP_013720858
AA seq 592 aa AA seqDB search
METTDLNDYTVIKEGEAEVLMHKKNKVFFNKAQVNNRDMSIAVLRAFISKRKQEHDAMLS
KRARSSGKVVEKDVSEVSKEGAPTENGEDNGKTNGEEHEASSKDGSKEAAKTTYEPARRE
LKPPRVLEALSASGLRALRYAREVEGIGQVVALDNDPASVEACQRNIKFNGLMSTSKVES
HLTDARVHMLTNPKEFDVVDLDPYGAPSIFLDSAVQSVADGGLLMCTATDMAVLCGANGE
VCYSKYGSYPLKGKYCHEMALRILLASIESHANRYKRYIVPVLSVQIDFYARVFVRIYTS
ASAMKNTPLKLSYVYQCIGCDSFHLQSVGRSLPKHNSVRYQAGLGPVVPQDCTHCGKKYN
MGGPIWSAPMHDQEWVTSILNGVKSMKDRYPAYDKICSMLTTISEELPDVPLFLSLHNLA
ATLKCTSPSAAMFRSAVINAKYRVSGSHVNPLGIKTDAPMEIIWDIMRCWVKNHPVKAQS
PDHPGSVILSKEPSHQADFSRHVGSLSKAQVKKVARFLPNPEKHWGPKVRAGRQITSKHV
SLIGHEAVNGHLNGHKEAAGAEEEEEEEKEDVVEDEPEMKRQKITEVIASSS
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atggagacaacagatctaaatgattatacagttatcaaggaaggagaagctgaggttcta
atgcacaagaagaacaaagtcttcttcaacaaagctcaggtgaataatagggacatgtcc
attgctgtcctgagggcgtttatatccaaacgcaagcaagagcatgatgcgatgttatcc
aaaagagctagatcttctggtaaagtggttgaaaaggatgtctctgaagtttccaaggaa
ggagctcctactgaaaacggtgaggataatggtaaaactaacggagaagaacatgaggca
tcatctaaggatggatcgaaggaagctgccaagaccacgtatgaaccggcccgaagggaa
ctcaagccgccaagagtccttgaggctctgtcagcttccgggttgcgggctttgagatac
gctcgtgaagttgaaggaattggtcaagttgtggctttagataatgacccagcatcggtt
gaagcttgccagagaaacataaagttcaatggcttgatgtctacttcaaaggtcgagtca
catctcactgatgctcgtgtccatatgctcaccaacccaaaagaatttgatgtggttgat
cttgatccatatggtgcgccgtctatcttccttgattcagctgttcaatcagttgccgat
ggtgggttgctcatgtgtacagcaactgacatggcagtgttgtgtggtgctaatggtgag
gtttgctattccaaatatggttcctatccactgaaaggcaaatattgtcacgagatggcc
ttgcggatcctcctcgctagcattgagagccatgctaaccgctacaagcggtatatcgtt
cctgtgctatcagtccaaattgatttctacgcccgtgttttcgtccgtatctacacttcg
gcgagtgcaatgaagaacactccactaaagctctcttacgtctatcaatgcattggttgt
gactcctttcatcttcaatccgttggaagatctctccctaagcataacagtgtgaggtat
caagcaggacttggtcccgttgttcctcaggactgcactcactgtgggaagaaatacaac
atgggtgggccgatatggtctgctccaatgcatgatcaagaatgggtgacttcgatactg
aacggtgttaagtccatgaaagatagatatcctgcttacgacaaaatatgctctatgctt
accacaatctcagaggaactgccagatgttccgctctttttgagccttcacaatctcgct
gcaacgctgaaatgtacttcgccttcagctgctatgtttagatcagcggtgatcaatgcg
aagtaccgtgtctccgggtcacatgtgaaccctctcgggattaaaactgatgctcctatg
gagattatctgggacatcatgcgttgctgggtgaagaatcatcctgtgaaggcgcagtca
cctgaccatcctgggagtgtgattctgtctaaagaaccgtctcatcaggctgacttttcg
cgccacgttggttcactaagcaaagcacaggtgaagaaagtagcgaggtttctgccgaat
ccagagaagcattggggaccaaaggtgagggctggtcgtcaaatcacaagcaaacacgtg
tcgcttattggtcatgaagctgtgaacggtcatctcaatggccacaaggaagcagcagga
gctgaagaagaagaagaagaggagaaagaagatgtcgttgaggatgagccagagatgaaa
cgccagaagattacagaggttattgcctcgtcatcatag

DBGET integrated database retrieval system