KEGG   Brassica napus (rape): 106427901Help
Entry
106427901         CDS       T04128                                 

Definition
(RefSeq) pyruvate decarboxylase 1-like
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106427901
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     106427901
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 106427901
NCBI-ProteinID: XP_013724073
AA seq 600 aa AA seqDB search
MDTIAGSLDTCKPDSGDVVRPNGPVQSTPRTVFTDSSNATLGRHLAHRLVEIGVNDVFSV
PGDFNLTLLDHLIAEPGLNLIGCCNELNAGYAADGYARSRGVGACVVTFTVGGLSVINAI
AGAYSENLPLICIVGGPNSNDYGTNRILHHTIGLSDFRQELTCFEAVTCYQAVVNNLEDA
HEQIDKAVSMALSESKPVYISISCNLAATPHPTFRSDPVPFSLSTKSSNMKSLEAAVEAT
VEFLNNAVKPVLVGGPKMRMAKASNALVELADASGYPLAVMPSAKGLVPEDHPHFIGTYW
GAVSSPFCAEIVESADAYLFAGPIFNDYASVGYSLLIKKEKAIIIHPDRVTVANGPTFGC
VLMSDFMTQLAKRVKRNDTAYENYHRIFLTQGKPLKSQPKEPLRVNTMFQHVQTMLSSET
AVIAETGDSWFNCQKLKLPRGCGYEFQMQYGSIGWSVGATLGYAQAQPEKRVVAFIGDGS
FQVTAQEVSTMIRNEQKSIIFLVNNGGYTIEVEIHDGPYNVIKNWNYTGFVDAIHNGEGK
CWTTKVKCEEELVEAITIASESKKDCLCFIEVILHKDDTSKELLEWGSRVSAANSRPPNQ
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atggacacaatagctggatcactcgacacgtgtaaaccggacagtggcgacgtcgtcaga
ccgaacggccccgttcaatctacaccacgcactgtcttcaccgactcctccaatgcaact
ctcggtcgtcatttagctcatcgtctcgtcgagattggcgtcaatgatgtcttctcagtt
ccaggcgacttcaacctcacgttgcttgaccatctcatagccgagccaggtctcaacctc
ataggctgttgcaacgagcttaacgctggctacgcggccgatggctacgctcgctcacgc
ggcgttggcgcttgtgttgtcactttcaccgttggaggactcagcgtgataaacgctatt
gcgggagcttacagcgagaatctgccgttgatatgtatcgtcggaggtccgaactcaaac
gactatggtactaacaggattcttcatcacaccattggcttgtctgatttcagacaagaa
ctaacatgtttcgaggctgtgacttgctatcaggctgtggtgaataacttggaagacgca
catgaacagatagacaaggctgtatcgatggctttgagtgaaagcaaacctgtgtacatc
agcatcagctgcaacttggctgcaactcctcatcctacattcagaagcgaccccgtccca
ttttctctctctacaaaatcgagcaacatgaagagtctagaagcagcggtggaagcaacc
gttgagtttctcaacaatgccgtgaagcccgtcttggttggtggtcctaagatgcgtatg
gccaaagcttctaacgctttggtcgagctagcagacgcttctggctaccctttagccgtg
atgccatctgcaaagggtctagttcccgaggaccaccctcacttcataggcacctattgg
ggagctgtaagctcacctttttgcgcagagattgttgaatcagcagacgcatatctattc
gcgggaccaatctttaacgactacgcctcagtaggctactctctactcatcaagaaggag
aaagcaatcatcatacatcctgatcgtgtcaccgtagccaacggtccaaccttcggatgc
gtcctaatgagcgacttcatgacccagctggccaaacgtgtgaaacggaacgatacagct
tacgagaactaccacaggatctttctcactcaagggaaaccgttaaagtcccaaccaaaa
gagcctttaagagtcaacacaatgttccaacacgttcaaacgatgctgtctagcgaaacc
gcggtgatagcggagactggtgactcttggttcaactgccagaaactaaagctgcctaga
ggatgcggctacgagttccagatgcagtacggatcaatcgggtggtcggtgggagctacg
ttgggatacgctcaagcacaacccgagaaacgagtggttgccttcattggagatggaagc
ttccaagtgacggctcaggaggtttcaacgatgatacgaaacgagcagaagagcattatc
ttccttgttaacaatggtggctacaccattgaggttgaaattcacgatggaccttataac
gtgattaaaaactggaactacactgggtttgttgatgcgatacataacggtgaaggtaaa
tgttggactactaaggtgaaatgcgaagaggagctagtagaggctattacgatagcgagt
gagtctaagaaggattgcttatgcttcattgaagtgattcttcacaaggatgatacgagc
aaagagttgcttgagtggggttcacgtgtttcagccgccaatagtcgtccccctaatcaa
tga

DBGET integrated database retrieval system