KEGG   Brassica napus (rape): 106428528Help
Entry
106428528         CDS       T04128                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: protein PHYLLO, chloroplastic-like
  KO
K14759  isochorismate synthase / 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase / 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase / O-succinylbenzoate synthase [EC:5.4.4.2 2.2.1.9 4.2.99.20 4.2.1.113]
Organism
bna  Brassica napus (rape)
Pathway
bna00130  Ubiquinone and other terpenoid-quinone biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    106428528
Enzymes [BR:bna01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     106428528
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     106428528
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     106428528
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.4  Transferring hydroxy groups
    5.4.4.2  isochorismate synthase
     106428528
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N MR_MLE_C TPP_enzyme_M_2 Abhydrolase_1 Abhydrolase_6 TPP_enzyme_C Hydrolase_4 Abhydrolase_2 DLH Thioesterase Abhydrolase_3 BAAT_C Ndr Esterase DUF2974 Chlorophyllase UPF0227 PGAP1 TPP_enzyme_M Lipase_3
Motif
Other DBs
NCBI-GeneID: 106428528
NCBI-ProteinID: XP_013724738
AA seq 1410 aa AA seqDB search
MDIFLYCLICQLLLQKSIQSSCQFHCKLSPEVVLSNNMLHQEAEVSNLLKDQANINAVWA
SAIIEECTRLGLTYFCVAPGSRSSHLAIAAANHPLTTCLACFDERSLAFHAIGYAKGSLK
PAVIITSSGTAVSNLLPAVVEASEDFLPLLLLTADRPPELQGVGANQAINQINHFGSFVR
FFFNLPPPTDLIPVRMVLTTVDSALHWATGSACGPVHLNCPFRDPLDSSPTNWSFNCLNG
LDTWMSNAEPFTKYFQVQSLKGNGKTSGQITEVLQVIKEAKKGLLLIGAIHTEDEIWASL
LLAKELMWPVVADVLSGVRLRKLSKPFLEKWTPVFIDHLDHALLSDSVRNLIEFDVVIQI
GSRITSKRVSQVLEKCFPFAYILVDKHPCRHDPSHLVTHRVQSNIVQFADCVLKSIFPWR
RSKLDGHLQALNGAIAREISFQLAAECSLTEPYVAHMLSKALTSKSALFIGNSMPIRDVD
MYGCSSGNYYSHVVDMMLSVESPCQWIQVTGNRGASGIDGLLSTATGFAVGCKKRVVCVV
GDISFLHDTNGLAILKQRIARKPMTVLVINNRGGGIFRLLPIAKRTEPSVLNQYFYTSHD
ISIKNLCLAHGVKYVHVGRKSELEETLLEPSLEEMDCIVEVESSIDANALVHSTLESFAR
QAANKSLGIILASSLLHPMIDNVLLFQVSGIQYSRYRVRLCDRPTIYSGESSHFHREGFI
LSLTLEDGSVGCGEVAPLDSSRENLMDVEGQLQLILHLMKGAKLSHMLPLLNGSFSSWIR
SELGITASSIFPSVRCGLEMALLNAMAVRHDSSLLGILHCQKEEIGSVQPHSVPICALVD
CEGTPSEVAYVARKLVEEGFSAIKLKVARRVNSVQDALVLQEVRRVVGDQIELRADANCR
WTFEEAITFGLLVKKCNLQYIEEPVQNKDDLIRFCEESGLPVALDETLDDFKECPLRMLS
KYTHPGVVAVVIKPSVVGGFENAALIARWAQQHGKMAVISAAYESGLGLSAYILFASYLE
TLNVKTFRERKQGMASLVAHGLGTYKWLNEDVMMNNSLGISRSPYSGFIEGSVADASKNL
RDVKINNDVIVRTSKGALVRTYELRVDVDGFSHFIRIHEVGQNVKGSVMLFLHGFLGTGE
EWIPIMKGISGSARCISVDIPGHGSSRVQSHASETQKTPPYSMEMIAEALYKLMEQITPG
KVTIVGYSMGGRIALYTALRFSNKIEGAVIVSGSPGIKDPVSRTVQRATDDSKARMMVDH
GLEIFLENWYNRGLWKSLRSHPHFRKIVASRLIHDDVLSVAKLLSDLSTGRQPSLWEELA
FCDTNVSLVYGEKDVKFKKIATRMYVEMSKSNKGENYIIETVEIPETGHAVHLESPLLLI
LALRKFLTRVRKNSAETXLSQKLLLALKET
NT seq 4233 nt NT seq  +upstreamnt  +downstreamnt
atggatatatttctctactgtttgatttgccagcttttgttgcagaaaagtatacaatca
tcatgtcagttccattgcaagctttcacctgaagttgttttatcaaacaacatgctgcat
caggaggctgaagtgagcaacttgttgaaagatcaggctaatatcaatgctgtatgggca
tcagctataattgaagaatgcactcgtcttggtttgacgtacttttgtgtagctcctgga
tcaaggtcctcccatcttgcaattgctgctgctaaccacccccttacaacgtgtcttgca
tgctttgacgaacgatctcttgcctttcacgccattgggtatgctaaaggatcccttaaa
ccggctgtcattataacatcatcaggaactgccgtttcaaatcttcttccagcggtggtt
gaagccagtgaggatttcttgcctctgctactacttactgcagatcgtccccctgaactt
cagggagttggcgcaaatcaagctataaatcaaataaaccactttggttcgttcgtcaga
ttcttcttcaatctccctcctccaactgatcttataccagtccggatggtccttactacc
gtagactctgctctacactgggcaacaggttctgcttgtggaccagtacatctgaattgt
ccttttagagacccacttgacagtagtccaacaaattggtcattcaactgcttaaatgga
ttagacacgtggatgtccaatgctgaaccattcacaaaatattttcaagtacaaagcctc
aagggcaatggtaaaacaagtggccaaattactgaggttttacaagtaatcaaagaggct
aagaagggccttcttcttatcggtgcaatccatacggaggatgaaatttgggcttctctt
ctcttggctaaagaactgatgtggccggttgttgcagatgtcttgtctggtgtacggctg
cgcaagctttctaaaccttttcttgagaagtggacccctgtttttattgatcatcttgat
catgccctgctttcggattctgttaggaatttgatagagtttgacgttgttatccagatt
ggaagtcggataacaagtaaaagagtttctcaggtgcttgagaaatgctttccgtttgca
tacattttggttgataagcatccatgccgacatgacccatcacacttggtcactcacagg
gtccaaagcaatattgttcagtttgctgattgtgtgcttaaatctatatttccatggagg
agaagcaaattagatggtcatctacaggcattgaatggcgctattgcccgagaaatttca
tttcaattagcagctgagtgctccctgaccgaaccttatgttgcacatatgctttccaaa
gcactgacttctaaatcagctcttttcatcggaaatagtatgccaataagggatgtggat
atgtatggatgtagttcgggaaactattattctcacgtggtagatatgatgttaagtgta
gaatcaccatgtcaatggatacaagtaactggaaatagaggagctagtggcattgatggc
ttgctcagcacggccactggctttgctgtaggatgcaagaagagagttgtctgtgtggtg
ggagatatctctttccttcatgatacaaatggattggcgattttgaagcagaggattgcg
aggaaaccaatgacagttctcgtgataaacaaccgtggaggtggaatcttccgacttctt
cctatagcaaagagaacagagcctagcgtgttgaatcaatatttctatacatcacatgac
atttccattaagaacttgtgcttggcacatggtgtgaagtatgtacatgttgggagaaaa
agtgaacttgaggaaaccctattggaacccagcctggaagagatggactgtattgtggag
gttgaaagctctattgatgctaacgcgctcgttcatagtactttggagagttttgcacgc
caagctgcaaataaatccttgggtattatcttggccagttcacttcttcatccaatgatc
gacaacgtacttcttttccaagtctctggaatacaatattcgcggtacagagtcagactg
tgtgacagacctacaatatattctggtgaatcctctcatttccatcgagaagggttcata
ctctccctgactttggaggatggaagcgttggctgcggagaggttgcacctttggacagt
agtagggagaacttaatggatgtggaggggcagcttcagttgattcttcatcttatgaaa
ggtgctaaactcagtcacatgcttcctttgttaaatggctcgttttcttcctggattcgg
agtgaacttggaatcactgcatcatcaattttcccaagtgtcagatgtggtctagaaatg
gctcttctgaatgcaatggcagtaagacatgattctagtttgttggggatacttcattgt
cagaaagaagaaattggttctgttcagccacactctgttccaatatgtgcccttgttgat
tgtgaaggtactccatcagaggtcgcatacgttgctagaaaacttgttgaagaagggttc
agtgctattaaacttaaagttgctcgtcgagtgaactccgttcaagatgctttagttctg
caagaagtaaggagagtcgttggcgatcaaatcgaactccgtgcagatgctaactgtcgc
tggacttttgaagaggccataacttttggtttattggtgaaaaagtgcaatctacaatat
attgaggaacctgtccagaataaagatgatcttataaggttttgtgaagaaagtggatta
ccagtggcacttgatgagactcttgatgattttaaggaatgtcctctgcgcatgctttcc
aaatatacccatcctggagtagttgctgttgttatcaaaccaagtgttgtgggagggttt
gagaatgcagcactgattgctcgctgggcacagcagcatggaaagatggctgttataagt
gccgcatacgaaagtggcctaggtttgtcagcatatattttgtttgcatcgtatttggag
acgctgaacgtcaaaacatttagagagagaaagcaagggatggcctctcttgtggcccat
ggtcttggaacctacaaatggcttaacgaagacgtaatgatgaataatagtctagggata
tctcgtagtccgtacagtggatttatcgaaggatctgttgctgatgctagcaaaaatcta
agggatgttaagataaacaacgatgttattgttagaaccagtaaaggagctcttgtccgg
acgtatgaactgagggtagatgtagatggtttctctcattttataagaatccacgaggtt
gggcagaatgtaaaaggaagtgtaatgttgtttcttcatgggtttcttggaactggtgaa
gaatggatccccatcatgaagggtatctcaggatctgcaagatgcatttcagttgatatt
cctggtcatggaagctcaagggtacaaagtcatgctagtgagacccagaagacccctcct
tactcgatggagatgatagcggaagcactgtataagttgatggagcaaattactcctggg
aaagttacaatagttggatattccatgggaggaagaatagcactgtacacggctttgagg
tttagcaacaagattgaaggagctgttattgtgtcggggagccccgggatcaaggatcca
gtgtcaaggacagttcaaagggcaacagatgattctaaagcacgaatgatggttgaccat
ggactagaaatctttctagagaactggtacaatagaggcttgtggaaaagtttgagaagt
catccccattttagaaaaatagttgcaagccgcttgatacatgatgatgtccttagtgta
gcaaagctcctctcagatctgagcaccgggagacagccgtcattgtgggaagagttggcg
ttttgtgatacaaatgtctcgcttgtttatggagagaaagatgtaaaattcaagaaaatt
gctactaggatgtacgttgagatgagtaaaagcaacaagggcgaaaactatattattgag
acggttgaaatcccagagactggtcatgctgttcatcttgagagccctctgctcttgatc
ctcgctcttagaaagttcttaacaagagtgcgcaaaaactctgcagagacanngctttct
cagaagctcttgttagcacttaaagaaacataa

DBGET integrated database retrieval system