KEGG   Brassica napus (rape): 106428691Help
Entry
106428691         CDS       T04128                                 

Definition
(RefSeq) probable protein S-acyltransferase 3
  KO
K16675  palmitoyltransferase ZDHHC9/14/18 [EC:2.3.1.225]
Organism
bna  Brassica napus (rape)
Brite
Enzymes [BR:bna01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     106428691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC TAS2R
Motif
Other DBs
NCBI-GeneID: 106428691
NCBI-ProteinID: XP_013724893
AA seq 217 aa AA seqDB search
MEKTILGNLEWQYVFLVRFITASMSDPKRNYPVFICFISTSTLLCIYIFALSWINLIRQP
GRLWSTMSHDIISVILIIYSFVSIWFVGGLTIFHVYLMSTNQTTYENFRSRYDKKENPYK
RGLLKNVKEVLFAKIPPSQLDLRAMVPEEDDGSEYESEYSSSIRYDNEKGGKLPKRVSPE
KLNLDNIDISNEYKTAKDDASSELDPSFFSSQLDLPK
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaaccatccttggaaacctcgaatggcaatacgtgttccttgtccgcttcatt
acagcttccatgtctgatccaaagagaaactacccggtcttcatctgcttcatctcaacg
tcaacgttgttatgcatatacatctttgcgttgtcatggatcaatctaatccgacagcct
gggagattgtggagtacaatgtctcatgacataatctctgtcattctcatcatctattca
ttcgtttctatctggttcgttggtggccttaccattttccacgtctatcttatgtctaca
aatcagacaacttatgagaattttcggtcccgttatgataagaaagaaaacccttacaag
agagggttgctgaagaacgttaaagaagtgttgttcgccaagatcccaccttctcaacta
gatctcagagcaatggtcccagaagaagatgacggatctgagtatgagtcagagtatagc
tcttccatcagatatgataatgaaaagggaggcaaactccctaaaagggtgagcccggag
aagcttaacttagataatattgacattagcaatgaatacaagacagctaaagatgatgct
tcttctgagcttgatccttctttcttctcatctcaactagacttgcctaagtaa

DBGET integrated database retrieval system