KEGG   Brassica napus (rape): 106430351Help
Entry
106430351         CDS       T04128                                 

Definition
(RefSeq) ATP-dependent RNA helicase DEAH12, chloroplastic-like isoform X1
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106430351
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106430351
Enzymes [BR:bna01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     106430351
Spliceosome [BR:bna03041]
 Complex C
  Other components
   Step II factors
    106430351
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Helicase_C IBR OB_NTP_bind HA2 DEAD AAA_22 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_2 Helicase_RecD AAA_19 Secretin_N AAA_30 AAA_29 ABC_tran RsgA_GTPase DUF2075
Motif
Other DBs
NCBI-GeneID: 106430351
NCBI-ProteinID: XP_013726593
AA seq 1757 aa AA seqDB search
MKSSLPPAYRGRSATNRHPSLPSASSSTNCRNFRSPPLNHRQYPSSSFPPNYRRDRPPAT
PNFIVQLLHPRTPAAEPSPSFSVRKQVISTLASLCGIPEESIHVPQFGCIAGSFSFRQWV
DALSAVVALWEYRLQGKTLLVPELVANVTVPSDVEELRDRLRGLFSGHVLSIMDNGDCVK
KVRAEIEEKSRQVESFSSKRGIKIEAFERKKAIEAERDLVVKRLEEFKNGMKSIVRFLEG
RDGEKDDVAVFSLEGDYDWPRIHSLIRRECRRLEDGLPIYAYRRNILKRIHGEQVMVLIG
ETGSGKSTQLVQFLADSGVAATESIVCTQPRKIAALTLADRVREESNGCYEENSVRCTPA
FSSTEEISSKVVFMTDNCLLQHYIKDRSLPGVSCVIIDEAHERSLNTDLLLALLKDLMCR
RIDLRLVIMSATADAYQLSDYFFGCGILCVTGRNFPVEIIYSPSDAEGSSGTGRIAPYAD
DVVKKAVEVHKTEKEGTILAFLTSQAEVEWACERFIAPSAVALPLHGKLSFEEQFRVFQN
HSGKRKVIFATNIAETSLTIPGVKYVIDSGMVKESKYEPRTGMSILRVCRVSQSSARQRA
GRAGRTEPGRCYRLYSKHEFELMNLNQEPEIRRVHLGVALLRILALGVDSVADFDFVDAP
DPEAIAMAVKNLVQLGAVVEKNGVLELTQEGHCLVKLGLEPKLGKLILGCFRHRMGKEGI
VLAAVMANASSIFCRVGSLDDKMKADCLKVQFCNPSGDLFTLLSVYKEWASLPRERRNKW
CWDNSLNAKSMRRCEDTVKELEICIERELSLVSPSYWVWNPTEGNNNKHDKRLKTVILAS
LAENVAMYTGYDQLGYEVALTGQQVQLHPSCSLLAFGQKPTWVVFGELLSVVDQYLVCVT
SFDFEALSLLDPPPPFDASHMDEWRLRVEKVAGCSSTLLKRFCGKSNCGLLSIVSRARSL
CVDERISIQVDVDQNEILLYAPPHDMDKVSALVSDALECEKKWMRNECLEKYIYHGRGQV
PMALFGSGAQIKHLEVDQRFLTADVFYYGDSFVDDRELLRFLERKIDVCICSIHKFAGNK
QDCDEKDKWGRITFLTPESAMKATEIQRFDFNGSVLKLFPSLATGGGGMFKMPSFPSVTA
MIRWPQRESTGRGVLKCPSGDVHSVFNGTSDIVIGTRYARFETDQRFSDSILITSIDSGL
VEADVLDALEFYTGRTDLEFFLLRRKSVRCPPPTVCADMLHKRIFACMSSSSPEPNCVQV
KVFEPKETDYFMRALITFDGRLHLEAAKALEELDGEVLPGCLSWQKIKCEQKFQSSIICP
ASVYNIVKRQLNAKLTSFERQRGGTWHLEPTHGGAYRVRISAYATKPISEMRRSLEELVR
GRPINHPGLTPRVLQHLSSRDGVILMRRIQHETETYILLDRHSLTVRICGSEEKIAAAEQ
ELVRSLLAYHERQQLEIRLRGPQLRPDLMKEVVNRFGPDLQGIKEKVDGVDLKLNTRYHV
IQVHGSVEMRQEVEKIVYELAREGSEPGGKPDDIEVECPICLCEVDDGYSLEGCSHLFCK
ACLLEQLEASMRNFDAFPILCSHADCGAPIVLADMRALLSQEKLDELFKASLSSFVTTSD
GNFRFCSTPDCPSVYRVAVGPRESGEPFICGACNAETCRRCHLEYHPYITCERYKLFKED
PDMSLKDWAKGKNVKECPFCKSTIEKSEGCNHLLCRCGKHICWVCLDFFTHQEPCYEHLR
AVHGGIGIFDELGIPLL
NT seq 5274 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttcacttcctccggcctaccgtggaagatcggcgactaatcgccacccatct
ttaccctcagcttcatcttcaaccaattgtcgtaacttccgctctccgccgctcaatcac
cgacaataccctagctccagtttcccgccaaattacagacgcgatcggcctccggcgacg
ccgaatttcatcgtccagcttctccacccgagaacccccgccgccgagccgtcgccgtcc
ttctcggttagaaagcaagtgatcagcaccctcgcttcgctctgcggaatcccggaggag
tccatccacgtacctcagttcggatgcatcgccgggagtttcagttttcgccagtgggtc
gacgcgctctccgccgtcgtggcgctctgggagtaccgcctccaggggaaaacccttttg
gtccccgagcttgttgctaacgtcaccgtcccgtcagacgtggaggagcttagagacagg
cttcgtggtctcttctcgggtcacgtgctttcgatcatggacaacggagattgcgtcaag
aaggtgagggccgagatagaggagaagtctcgtcaagttgagtccttttcgtctaaaaga
ggtataaagattgaggcttttgagagaaagaaggctattgaggcggagagagacttagtt
gtaaagcgtcttgaagagttcaagaatggtatgaagagtattgtgcggtttcttgaagga
agagatggagaaaaagatgacgtggctgtgtttagtttggaaggagactatgattggccg
cgtattcatagtttgatccgcagggagtgtcgtaggctagaggatgggctccctatctat
gcttaccgtcgtaatattttgaagaggattcatggcgaacaggtaatggtattgatcgga
gaaaccggttcagggaagagcactcagttagttcagttccttgctgattccggagttgct
gctactgaatcaatagtttgcacacaaccaaggaaaattgccgccttgacattggctgat
cgggtcagagaagaaagcaatggttgctacgaggagaactctgtccgctgcactccagct
ttctcttccaccgaggagattagttccaaagtcgtgttcatgactgataactgtctgctt
caacactacattaaagaccggagtttgcctggcgtttcatgcgttattattgacgaagct
cacgagagaagcttgaacacggaccttcttctggcgttgcttaaagatctgatgtgcaga
agaattgacttaaggcttgtcatcatgtccgccacggcggatgcttaccagctctcggac
tatttctttggctgtgggattctttgcgtcaccggaaggaactttccggtggagattatt
tattcccctagcgacgcagaagggagttctggtaccggacgtattgctccgtatgctgat
gatgttgttaagaaggcagtggaagtgcataaaacagagaaagaaggaaccatccttgcg
ttcttgacttctcaagcagaggttgaatgggcctgcgagaggtttatagctccatctgca
gttgctttacctttgcatggaaagctttcattcgaggagcagtttagggtgttccagaac
cattctgggaaacgaaaagtgatcttcgccacaaatattgcagagacctctctgactatc
cctggtgtcaagtatgtgatcgactccgggatggtgaaagaaagtaaatacgaacctaga
acgggtatgagcatcctcagggtttgccgagtcagtcaaagctcagctcggcaacgcgct
ggtcgtgctggaaggacagagcccggaagatgttacagactctactcaaagcacgagttt
gagttgatgaatcttaaccaggagcctgagattcggagggtccatcttggtgtagcgctt
ttgaggattcttgctctgggtgttgacagcgtggcggattttgactttgttgacgcgcct
gaccctgaagccatcgctatggctgtcaaaaatcttgttcagttgggtgctgtcgttgag
aagaatggtgttcttgagttaacacaggaagggcattgtttagtcaagcttggtctggag
ccaaagcttgggaagttgattttaggttgcttcagacacagaatgggcaaagaggggatt
gttcttgctgctgtcatggctaatgccagtagtatattttgcagagttggcagccttgat
gacaagatgaaagctgattgcctaaaggtgcaattctgcaaccctagtggagacttgttc
actcttctttcggtgtacaaagaatgggcatctcttccgcgagagagaagaaataaatgg
tgctgggataatagtctaaatgccaaatcaatgaggagatgtgaagacactgtcaaggag
ctggagatatgcattgagagagaactttctcttgtcagtccaagttactgggtttggaat
ccaaccgagggtaataataataaacacgacaagcgtttgaaaacggttatacttgcatcc
ctcgctgaaaacgtggcgatgtacactggctatgatcagcttgggtacgaggtagcgttg
actggtcaacaagttcagttgcatccgtcgtgttctttgctagcgtttggacagaagcca
acttgggttgttttcggtgagctgctatcagtcgtcgaccagtacttggtatgtgtaact
tcgttcgattttgaggctttgtctctgcttgatccacctccaccttttgatgcgtctcat
atggatgaatggaggctccgagtggagaaggtggctggttgtagcagcactctgctaaaa
agattctgtgggaaatctaactgtggtctgctttcgattgtttctcgtgccaggtcgctt
tgtgtggatgaaaggattagcattcaagttgatgtcgatcagaatgagattctactgtat
gcacctccccacgacatggacaaagtctcggccctggtgagcgatgcattggagtgtgag
aagaagtggatgcggaacgaatgcttggagaagtatatataccatggccggggacaagta
cctatggcactgtttggttctggtgctcagataaagcatcttgaagttgatcagagattc
ttgacggccgatgtattttattacggcgacagtttcgttgatgacagagagcttctgagg
ttcctggagaggaagatcgatgtgtgtatctgctctattcataagtttgctgggaacaag
caagactgtgatgagaaggacaagtggggtaggataacctttctcactccggaatctgct
atgaaggcaacagagattcagagatttgatttcaacggatcggtgcttaaactatttcca
tcgctggcaactggtgggggaggaatgttcaagatgccttcattcccttctgttacagct
atgattcgttggccgcaaagggagagcactggcagaggcgttcttaagtgcccatccggt
gatgtccacagcgtatttaatgggacctctgacattgtgataggaacaagatacgcccgc
tttgagacggatcaaaggttcagcgattcaatattgattactagtattgactcaggtctt
gtggaagcagacgttttagatgctttggagttctacacggggagaacagatttggaattt
ttcctgttgagaagaaagagcgtgcggtgtccacctcctactgtctgtgcagatatgctg
cataagaggatatttgcgtgcatgtcatcgagcagtccagagccgaactgcgtccaagtc
aaagtttttgaaccaaaagaaacagattatttcatgcgagcgttgattacttttgatgga
agattacacttggaagccgcgaaagctttggaggagttagatggagaggtgctacctgga
tgcctttcatggcagaagatcaaatgcgagcaaaagtttcagagctccataatctgtcct
gcttctgtctacaacatagtcaaaagacaactgaatgctaagttaacaagcttcgagaga
caaagaggaggtacttggcatctggagccaacacatggtggtgcttaccgtgttagaata
tctgcttatgcaacaaaacccatctcagagatgcggagatctcttgaagaactcgtaaga
ggaagacccataaaccatccaggcctaaccccaagggtcttgcagcatctctcttccaga
gacggtgttattctgatgcggaggatccaacacgagactgaaacgtacattttactagac
aggcacagtctcacagtgcgcatttgtggatcagaagagaaaatcgctgcggctgagcaa
gaactggttcgttcgcttctggcctatcacgagaggcagcagcttgaaatccgcctccga
ggtcctcagttacgtcctgacctaatgaaggaagttgtgaaccggtttggtccggatctc
caaggtatcaaagagaaggtagatggcgtggacctcaagctcaacacgcggtaccatgtt
attcaggttcatgggagcgtggagatgaggcaggaagtagaaaagatcgtctacgaactt
gcacgtgaaggtagtgaaccgggaggaaaaccagatgacattgaagttgaatgccccatc
tgcctgtgtgaggttgatgatggctactctctcgaaggatgctcgcacctcttctgcaaa
gcttgtttgttggaacagctcgaggcatcgatgagaaacttcgacgcgtttcccattctt
tgctctcacgcggactgtggagctccgatagtactcgctgatatgagagcgctcttatca
caagagaagctagatgagctcttcaaagcctccctatcctcttttgtgacaaccagcgat
ggtaacttccggttttgctccactcctgactgcccttccgtttaccgcgtagctgttggt
cctcgagagtcaggggagccgttcatctgcggagcttgtaacgcagagacgtgcagaagg
tgccacctggagtatcacccgtatatcacttgcgagaggtacaaactgtttaaagaagat
cctgacatgtcgttgaaagactgggcgaaggggaagaacgtgaaggagtgtccgttttgc
aagtcgacgatagagaaatctgaagggtgtaaccatctgctgtgccggtgtgggaagcat
atctgctgggtttgcttagacttcttcactcatcaagagccttgttatgagcatttgaga
gcagtccatggtggaataggcatcttcgatgagctcggcatccccttgctttga

DBGET integrated database retrieval system