KEGG   Brassica napus (rape): 106430724Help
Entry
106430724         CDS       T04128                                 

Definition
(RefSeq) succinate-semialdehyde dehydrogenase, mitochondrial-like
  KO
K17761  succinate-semialdehyde dehydrogenase, mitochondrial [EC:1.2.1.24]
Organism
bna  Brassica napus (rape)
Pathway
bna00250  Alanine, aspartate and glutamate metabolism
bna00650  Butanoate metabolism
bna01100  Metabolic pathways
Module
bna_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    106430724
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    106430724
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.24  succinate-semialdehyde dehydrogenase (NAD+)
     106430724
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106430724
NCBI-ProteinID: XP_013726966
AA seq 531 aa AA seqDB search
MVLGAAARVASVGCRRLVCSSSHASPLLVSSSQCRQMSMDAQSVSEKLRSSGLLRTQGLI
GGKWIDSYDKTTIKVNNPATGEIVADVACMGVKETNDAIASSYEAFQSWSRRTAGERSKV
LRRWFDLLVAHKEELGQLITLEQGKPLKEAIGEVAYGASFIEYYAEEAKRVYGDIIPPNS
SDRRLLVLKQPIGVVGAITPWNFPLAMITRKVGPALASGCTVVVKPSELTPLTALAAAEL
ALQAGVPPGALNVVMGNAPEIGDALLASPQVRKITFTGSTAVGKKLMAAAAPTVKKVSLE
LGGNAPSIIFDDADLDVAVKGTLAAKFRNSGQTCVCANRVLVQDGIYDKFAEAFSEAVQK
LEVGDGFKEGATQGPLINDAAIQKVESFVQDAVSKGAKVLLGGKKHSLGMTFYEPTVIRD
VTSNMIMSKEEIFGPVAPLIRFKTEEDAIRIANDTIAGLAAYIFTNSVQRSWRVSEALEY
GLVGVNEGIISTEVAPFGGVKQSGLGREGSKYGMDEYHEIKYICMGDMNRQ
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggtactcggagctgcagcgcgtgtagctagcgtcggttgccgtaggctcgtctgctcc
tcctcacatgcttcccccctcctcgtctcctcctctcagtgccgccagatgagtatggat
gcacaaagcgtctccgagaagctcaggagctcgggacttttgcgaacacaaggtctaata
ggaggaaagtggattgattcgtatgacaagaccacaatcaaggttaacaatccagcaacg
ggtgaaattgtagctgatgttgcatgtatgggagtcaaagagacgaatgatgctattgct
tcttcttacgaagcattccaatcttggagcagacggactgctggagagaggagtaaagtt
ttaaggcgatggtttgaccttctggttgcacacaaggaagaacttggacagcttataact
ttggagcaaggaaaaccactaaaggaggctataggagaggtcgcatatggggcaagtttt
attgagtactatgcggaggaggcaaaacgtgtatacggtgacataattcctcctaattcg
tctgatcgccggttgttggtcctaaaacagcctattggtgttgttggcgcaattacccct
tggaactttcccttagctatgattactcgaaaggttggtcctgctctggcttctggttgc
acggtggttgttaaaccatctgaacttacgcccctgacagcacttgctgcggccgaactt
gcacttcaagctggagttcctccaggtgcacttaatgtggtcatgggaaatgctcctgaa
attggggatgctttgcttgcaagtccacaggtgaggaaaatcacgttcacaggatcgaca
gcagttgggaagaagttgatggcagctgctgcacctaccgtcaagaaggtttctctagaa
cttggcggcaatgcaccctccataatatttgatgatgcagacctggatgtagcagttaaa
ggaacgcttgcagcgaaatttaggaacagtggtcagacatgtgtatgtgcgaacagagta
cttgtgcaagatggtatctatgataaatttgctgaggccttttctgaagcggttcaaaaa
ttagaagtaggagatggctttaaggagggggcaacccagggtccacttataaacgatgca
gcaattcagaaggtagagtcattcgtgcaagatgccgtttccaagggagcaaaagtcctt
ctcggcggcaaaaagcacagtctagggatgactttttatgagcctactgttatccgtgat
gttacgagtaacatgattatgtctaaggaggagattttcggacccgtagctccccttatt
cggtttaagactgaggaggacgctatcagaatcgctaatgacactattgcaggacttgct
gcgtatatattcacaaacagtgtccaacgatcgtggcgtgtatccgaagcacttgaatac
ggacttgtaggggtgaatgaaggaatcatatcaacagaggtggctccattcggtggagtg
aagcagtctggacttggaagggaaggatctaagtacggtatggacgaataccatgagatc
aaatacatatgcatgggagatatgaacagacagtga

DBGET integrated database retrieval system