KEGG   Brassica napus (rape): 106430809Help
Entry
106430809         CDS       T04128                                 

Definition
(RefSeq) non-specific phospholipase C6-like
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bna  Brassica napus (rape)
Pathway
bna00562  Inositol phosphate metabolism
bna00564  Glycerophospholipid metabolism
bna00565  Ether lipid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106430809
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106430809
   00565 Ether lipid metabolism
    106430809
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bna02042]
    106430809
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     106430809
Bacterial toxins [BR:bna02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   106430809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase Sulfatase DUF5566 Tn7_TnsC_Int
Motif
Other DBs
NCBI-GeneID: 106430809
NCBI-ProteinID: XP_013727061
AA seq 518 aa AA seqDB search
MKQPTSRFASTFSHFLALYCLLTLSHVALGSHQWQSPIKTVVVLVMENRSFDHLLGWMKK
SVNPSINGVTGQECNPVPNSTQTICFTSDAEFVDPDPGHSFEAVEQQVFGSGQIPSMMGF
VEQALSMPGNLSETVMKGFRPEAVPVYAELVKEFAVFDRWFSSIPGPTQPNRLFVYSATS
HGSTSHVKQQLAQGFPQETIFDSLHSDDVDFGIYFQNIPTTLFYRNLRQLKYIFKLHQYD
LKFKKDAAKGNLPSLTVIEPRYFDLKGLPANDDHPSHDVANGQKLVKEVYETLRSSPQWN
ETLLVITYDEHGGFYDHVKTPYVGIPNPDGNTGPAPGFFKFDRLGVRVPTIMVSPWIQKG
TVVSEAKGPTESSEFEHSSIPATIMKLFNLSSNYLTHRDAWAATFEDVVSHLISPRTDCP
MTLPAVAPMRSTDPKEDAALSEFQSEVVQLAAVLNGDHFLSSFPDEVGKKMTVKQAHEYV
KGATSRFIRASKEAVKLGADKSAIVDMRSSLTTRPRNL
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaaccaacttcaagatttgcctccactttttcgcactttctcgcactctactgt
cttctcacgctatcccatgtagctctaggatcccatcaatggcaatcaccaatcaaaaca
gtcgtcgttttggttatggagaatcgatccttcgatcacctcctaggctggatgaagaaa
tcggttaacccttccataaacggtgtaacgggtcaagaatgtaacccggttccgaattct
acacaaaccatatgtttcactagcgacgctgagtttgtggatccggatccgggtcattcg
ttcgaagctgtggagcaacaggtattcgggtcgggtcagatcccgtccatgatgggtttc
gtcgagcaagcgctttcgatgccgggaaatctgtcggaaaccgtcatgaaaggttttcgg
cctgaagctgtaccggtttatgccgagctggttaaagaattcgccgtgttcgacaggtgg
ttttcttctattcctggtccgactcaaccgaaccgtttgtttgtctattcggctacctca
catggttcaacaagccatgtcaagcaacagcttgctcaagggtttccacaagaaactata
ttcgattcactccacagcgacgacgtcgatttcggaatatacttccagaatattccgacc
acattattctaccgtaatctccgacagctaaaatacatatttaaattgcatcagtatgat
ctgaaattcaagaaagacgcagcaaaaggaaacttaccgagcttaaccgtcattgaaccg
aggtatttcgacctcaagggcttaccggccaatgacgatcacccatctcacgacgtagct
aacggccaaaagctggttaaagaagtgtacgagacacttaggtcgagtccacagtggaac
gagacgctcctagtcataacctatgatgagcatggtgggttttatgatcatgtgaagact
ccttatgtcggtataccgaacccagatgggaataccggaccggcccctggtttctttaaa
tttgaccggttaggtgttcgggttcctacaattatggtgtcaccttggattcagaaagga
actgtggtgagtgaggcaaaagggccaacagagagctcagagttcgagcattcatcaata
ccagcgaccatcatgaaactcttcaatctctcttccaattacttaacacatagggatgct
tgggctgctactttcgaagacgtggtttctcacttaatctctcctcgaaccgattgtccc
atgactctacctgccgttgcacccatgagatccactgatcctaaagaagacgcagcccta
tctgagtttcagagtgaagttgttcagcttgcagcggttctcaatggcgatcacttcctc
agtagcttcccggatgaagttgggaagaagatgactgtgaaacaagctcatgagtatgtc
aaaggagctacttctcggttcattagagctagcaaagaagcagtgaagcttggtgccgat
aaatctgccattgtcgatatgcgatcttcgctcactactaggccacgcaacctgtga

DBGET integrated database retrieval system