KEGG   Brassica napus (rape): 106434208Help
Entry
106434208         CDS       T04128                                 

Definition
(RefSeq) alcohol dehydrogenase-like 2
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
bna  Brassica napus (rape)
Pathway
bna00010  Glycolysis / Gluconeogenesis
bna00071  Fatty acid degradation
bna00350  Tyrosine metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106434208
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106434208
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    106434208
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     106434208
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     106434208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C 2-Hacid_dh_C UDPG_MGDP_dh_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 106434208
NCBI-ProteinID: XP_013730497
AA seq 389 aa AA seqDB search
MDKTSSISIHEGKPIRCKAALCKKAGEALVIEEIQVDPPQAYEVRIKILCTSLCHTDVTF
WKLDRGPLARFPRILGHEAVGVVESIGDHVNGFKQGDVVLPVFHPHCEECRDCKSPKSNW
CSRYCDDFFSNTRRYGMDSRFKDSSGEDIYHFLFVSSFTEYTVVDIAHLVKISPEIPVEK
AALLSCCVSSGVGAAWKVADVEEGSTVAIFGLGGVGLAAAEGARLRGAAKIIGVDLNPDK
FEIGKRFGITDFVNPALSGEKKISQVIKEMTEGGVDYSFECIGLTSLMEEAFNSTRTGSG
KTVILGMEKQMLPISLGSHDLLRGRAICGTLFGGLKPKLDIPILVDSYLKRELNLNGFIT
HELSFEEINKAFDLLVKGETIRCVLWMDK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggacaagacatcttcaatctccatccacgaaggaaaaccgattagatgcaaagcagca
ttatgtaaaaaagcaggagaagctttggtcatagaggagatccaagttgatccacctcaa
gcttacgaagttcgaattaagatcttatgcacttctctttgccacactgatgttactttc
tggaaactagaccggggacctcttgcaaggtttccgaggattctaggacacgaagcagtg
ggtgttgtcgagagcattggagatcatgtaaacggattcaaacaaggagatgttgtttta
ccagtgtttcaccctcactgtgaggaatgtagagactgcaaatccccaaagagcaactgg
tgctcgaggtattgtgacgatttcttttcaaacacgaggcgatatggtatggattccagg
tttaaagattcctcgggagaagatatttaccattttttgttcgtctcgagttttactgaa
tacaccgtcgttgacatcgcacatctcgtcaaaatctcccctgagatccccgttgaaaaa
gcggccttgctcagctgctgcgtctcctcaggagttggcgctgcatggaaggtggctgac
gtagaggaaggttcaactgttgctatctttggccttggtggtgttggacttgcggctgct
gaaggcgccaggctacgtggggctgcaaagatcatcggtgtagatctcaatcccgacaaa
tttgaaataggtaaacgatttggcatcacggacttcgtcaaccctgctttatctggagag
aaaaagattagccaagtgataaaagaaatgaccgaaggaggagttgattatagttttgaa
tgcattggtttaacgtccttgatggaggaggctttcaatagcacacgcacgggatcgggt
aaaacggtaattttggggatggaaaaacagatgttgccaataagcttgggtagtcatgat
cttctcagaggccgagctatatgcggaactttattcggtggtttgaaacctaaacttgat
attccaatactcgtggattcttatctaaaaagggaacttaatctgaacggttttattaca
cacgagttaagctttgaggaaattaacaaggctttcgatttattggtgaaaggagagact
attcggtgtgtcctatggatggataaataa

DBGET integrated database retrieval system