KEGG   Brassica napus (rape): 106440302Help
Entry
106440302         CDS       T04128                                 

Definition
(RefSeq) pyruvate, phosphate dikinase regulatory protein 1, chloroplastic-like
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106440302
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     106440302
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     106440302
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase AAA_18
Motif
Other DBs
NCBI-GeneID: 106440302
NCBI-ProteinID: XP_013737387
AA seq 399 aa AA seqDB search
MAFLSAVKLQGRPPSISSSLNPNPKPVGSDSVSLDVSIPDSERKPRKFSSKLSRWNRART
LRSGVKVDRTVNNESNSTTGPIVNMNFPDISTVESDVSSINRDHETDFTAAKSIYIVSDG
TGWTAEHAVNAALGQFDYCLVDRGCPVNTHLFSGIEDRETLMEIIKQAAIEGAMVMYTLA
DPSMAEAAMRACKLWSISSLDILGPITDAISSHLGANPSGLSRGVSNSSLNEDYFKRIEA
IEFTIKHDDGALPENLEKADIVLVGVSRTGKTPLSTYLAQKGYKVSNVPIVNGVDLPRTL
FEVDSRKVFGLMINPVVLQGIREARAKSLGLGSGFEIKYSELRSVREELELAKRIFAENP
SWPVIEVTERAIEETAAVVLRLYDERQSNRAMPRISKCY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcttttctctcggcggtgaagttgcagggacgtccaccatcgatctcgtccagtctc
aacccaaatcccaagcctgtaggttcggattccgtttccttagacgtctccatacctgac
tccgaacgaaagcctcggaaattcagctcaaagctgagtcgttggaacagagcacgaacc
ttacgctccggcgtgaaggtggaccgtacggttaataatgagtcaaacagtacgaccggt
ccgatcgtgaatatgaatttccctgatatttcaacggtggaaagtgacgtgtcatcaatt
aaccgtgatcacgagacggatttcacggcggcgaagtcgatttatatagtctctgacgga
actggatggacggcggaacacgccgttaacgctgctttgggccagttcgattattgcttg
gtcgaccgtggctgtcccgttaatacccatctcttctcagggatcgaggatagagagacg
ttgatggagatcataaagcaagctgcaatagaaggagcaatggtaatgtacacattagct
gatccatcaatggcggaagcagccatgagagcatgcaagctatggagcatctcttcacta
gacatcctaggaccaatcacagacgcaatctcctctcacttaggagctaacccttcaggt
ctttcgcgtggcgtctcaaactcatctctcaacgaagactacttcaaaagaatcgaagca
atcgaattcacaatcaaacacgacgacggtgccttgccagagaatcttgaaaaggcagac
attgttcttgtaggtgtctccaggacagggaagacaccactctctacttacttagctcaa
aagggttacaaagtctctaacgtaccgatcgtgaacggtgtggatcttcccaggactctt
ttcgaggttgattcgagaaaggtttttggtctgatgattaacccagtcgtgttgcaaggg
ataagggaggctagagctaagagtcttggtcttggttctggttttgagattaagtactct
gagttgagatctgttagggaggagcttgagcttgctaagagaatctttgcagagaatccg
agttggccagtgatcgaagtaacagagagagcaatagaggaaactgctgcagtggttttg
aggctttacgacgagagacaaagcaatcgagcgatgcctcgcatctctaaatgctactaa

DBGET integrated database retrieval system