KEGG   Brassica napus (rape): 106440803Help
Entry
106440803         CDS       T04128                                 

Definition
(RefSeq) heat shock 70 kDa protein 6, chloroplastic isoform X1
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bna  Brassica napus (rape)
Pathway
bna03040  Spliceosome
bna04141  Protein processing in endoplasmic reticulum
bna04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    106440803
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106440803
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106440803
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bna01009]
    106440803
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bna03041]
    106440803
   03009 Ribosome biogenesis [BR:bna03009]
    106440803
   03110 Chaperones and folding catalysts [BR:bna03110]
    106440803
   04131 Membrane trafficking [BR:bna04131]
    106440803
   03051 Proteasome [BR:bna03051]
    106440803
   03029 Mitochondrial biogenesis [BR:bna03029]
    106440803
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    106440803
Protein phosphatases and associated proteins [BR:bna01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     106440803
Spliceosome [BR:bna03041]
 Complex B
  Other components
   Prp19 complex
    106440803
 Complex C
   Prp19-CDC5 complex
    106440803
Ribosome biogenesis [BR:bna03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    106440803
Chaperones and folding catalysts [BR:bna03110]
 Heat shock proteins
  HSP70 / DNAK
   106440803
Membrane trafficking [BR:bna04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    106440803
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    106440803
Proteasome [BR:bna03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    106440803
Mitochondrial biogenesis [BR:bna03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    106440803
Exosome [BR:bna04147]
 Exosomal proteins
  Proteins found in most exosomes
   106440803
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl StbA FtsA FGGY_C DUF5398 Hydantoinase_A baeRF_family12
Motif
Other DBs
NCBI-GeneID: 106440803
NCBI-ProteinID: XP_022572609
AA seq 713 aa AA seqDB search
MASSTAQIHVLGGIGFAASSKRNLNGKANLKPRSAFFGTRAGPFSAQTSAFLKMNTRKGS
RYAVGPVRVANEKVVGIDLGTTNSAVAAMEGGKPTIVTNAEGQRTTPSVVAYTXSGDRLV
GQIAKRQAVVNPENTFFSVKRFIGRRMNEVDEEAKQVSYRVVKDDNGNVKLECPAIGKQF
AAEEISAQVLRKLVDDASRFLNEKVTKAVVTVPAYFNDSQRTATKDAGRIAGLEVLRIIN
EPTAASLAYGFERKSNETILVFDLGGGTFDVSVLEVGDGVFEVLSTSGDTHLGGDDFDKR
VVDWLASNFKKDEGIDLLKDKQALQRLTEAAEKAKIELSSLTQTNMSLPFITATADGPKH
IETTLTRAKFEELCSDLLDRCKTPVENSLRDAKLSFKDIDEVILVGGSTRIPAVQEVVRK
LTGKEPNVTVNPDEVVALGAAVQAGVLAGDVSDIVLLDVTPLSIGLETLGGVMTKIIPRN
STLPTSKSEVFSTAADGQTSVEINVLQGEREFVRDNKSLGSFRLDGIPPAPRGVPQIEVK
FDIDANGILSVSASDKGTGKKQDITITGASTLPKDEVEQMVQEAERFAKDDKEKREAIDT
KNQADSVVYQTEKQLKELGEKIPGEVKEKVEAKLQELKDKLASGTTQEIKDTMAALNQEV
MQIGQSMYNQPGAGAGAGAAGAGPSPGGEDASSAASASKGGDDVIDADFTDSK
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctccaccgcccagattcacgtcctcggcggaattggattcgccgcttcttcc
aagaggaacctcaatggcaaagctaacctcaagccgagaagcgccttcttcggcaccaga
gccggtcctttctctgcccagacctccgccttcctgaaaatgaacacccggaaaggctcc
agatacgccgtaggcccggtccgcgtggcgaacgagaaggtcgtcgggatcgatttggga
acgacgaactccgccgtggctgcgatggaaggaggcaagccgacgattgtgacgaacgcc
gaaggtcagaggacgacgccgtctgtggtggcgtacacgnagagcggtgacaggctcgtg
gggcagattgcgaagaggcaggcggttgttaatccggagaacacgttcttctcggtgaag
aggtttatcggtaggaggatgaatgaggttgatgaggaggctaagcaggtgtcttacaga
gttgtgaaggatgataacgggaatgttaagctcgagtgtccagccattgggaaacagttt
gctgctgaggagatttcagctcaggttttgaggaagcttgtggatgatgcttcgaggttc
ttgaatgagaaagtgactaaggctgttgtcactgtgcctgcttacttcaatgactcgcag
aggacagctactaaagatgctggtcgtattgctgggttggaagttcttcgtattatcaat
gagcccacggctgcttctttggcttatgggtttgagagaaagagcaatgagactattcta
gtctttgatcttggtggtggtacctttgatgtctcagtgcttgaggttggtgatggtgtg
tttgaagtactttctacttctggtgacacacatttgggtggtgatgattttgacaaaaga
gttgttgattggcttgcttcaaacttcaaaaaagatgaaggcattgatcttctgaaagac
aaacaagcacttcagaggctgacagaagcagcagaaaaagctaaaatcgagctttcttcg
ctgactcagacaaatatgagtttgccatttatcacggccacagctgatggacctaaacac
atagagaccactctcacacgtgccaagttcgaagaactatgctctgatttactcgacagg
tgtaagactcccgttgagaattcgctgagagatgcaaagctcagctttaaagatattgat
gaagtaatccttgttggtggatccacacgtattcctgctgttcaggaagttgtcaggaag
ctgactgggaaagaacccaatgtcacagtaaaccctgatgaggttgtagctctaggtgcc
gctgtccaggctggtgttctggctggagatgtgagcgacattgtccttcttgacgtgaca
ccgctttccattggtttggaaacccttggtggtgttatgaccaagattattccaaggaac
tcaactctgcctacttctaagtcagaagtattctcgactgccgctgatggacagacaagt
gttgagattaatgtgctccaaggggagagagagtttgtccgggataacaagtctcttggc
agcttccgtctagatggtatcccaccagcaccacgtggagttccacagatcgaagtcaaa
tttgacattgatgccaatggtattctgtccgtcagtgccagtgacaaaggcaccggaaag
aaacaagacatcaccattaccggtgccagtacattgcccaaggacgaggtagagcaaatg
gtccaagaagcagaaaggtttgcaaaggatgacaaggagaagagagaagcaattgacaca
aagaaccaagcggactcagtggtgtaccagacagagaagcaacttaaagaactcggagag
aagattccaggtgaagtgaaagagaaggtggaggccaagctacaagagctgaaggacaag
cttgcaagtggaaccactcaagaaatcaaggacacaatggctgctcttaaccaagaagtg
atgcagattggtcagtcgatgtacaaccagcctggagctggagctggagctggagcagca
ggtgcaggtccttcccccggaggtgaagatgcttcatcagcagcttcagcaagtaaaggt
ggagatgatgtgattgatgctgacttcacggacagcaaatga

DBGET integrated database retrieval system