KEGG   Brassica napus (rape): 106440920Help
Entry
106440920         CDS       T04128                                 

Definition
(RefSeq) polyamine oxidase 1-like
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
bna  Brassica napus (rape)
Pathway
bna00330  Arginine and proline metabolism
bna00410  beta-Alanine metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    106440920
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106440920
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     106440920
    1.5.3.16  spermine oxidase
     106440920
    1.5.3.-  
     106440920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 Pyr_redox_3 FAD_binding_2 Thi4 HI0933_like FAD_binding_3 GIDA NAD_binding_9 FAD_oxidored Shikimate_DH Pyr_redox Lycopene_cycl TrkA_N
Motif
Other DBs
NCBI-GeneID: 106440920
NCBI-ProteinID: XP_013738149
AA seq 471 aa AA seqDB search
MTTSSVIIIGAGISGITAAKELAEKGVDDVLILEATERIGGRIQKQSFGDVSVELGAGWI
AGVGGKESNPVWELASRLNLRTCFSDYTNARYNIYDQSGEIFPTGFAADSYKKAVDSAIL
KLKSLEAECDGQEAEEAPSSPKTPIELAIDFILHDFEMAEVEPISTYVDFGEREYLVADE
RGYESLLYKMAEGFLYTSDGNILDNRLKLNKVVREVQQSRNGVVVKTEDGSEYEANYVIV
SASIGVLQSNLISFQPPLPKWKTEAIQKCDVMVYTKIFLKFPHCFWPCGPGQEFFIYAHE
QRGYFTFWQHMENAYPGSNILVVTLTNEQSKRVESQSDEETLKEAMSVLRDMFGPTIPYA
TDILVPRWWNNRFQRGSYSNYPMISDNQLQRNVKAPFGRIFFTGEHTSEKFSGYVHGGYL
AGMDTSKTLLEEMKQSLLLQPLLAFTESLTQTDQRSNPQMYTNVNLISGRS
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctcctccgtaattatcatcggcgccggaatctccggaatcacggcggctaag
gagctggccgagaagggagtggatgacgtgttgatcctcgaggcgaccgaacggatagga
gggagaatacaaaagcagagtttcggtgacgtgtcggtggagctcggtgccggctggatt
gccggcgtcggtggtaaagagtctaaccctgtttgggagctcgcttctcgtcttaaccta
cgtacatgcttctctgactacaccaatgctcgttacaatatctacgatcaaagtggagaa
attttcccgactggattcgctgctgactcgtataagaaggcggttgactcggcgattctg
aagctaaagagccttgaagctgaatgtgatggccaagaagctgaagaagctccttcgtca
ccaaagacgcctatagaactcgctattgacttcatcctgcatgatttcgagatggcagag
gttgagccaatatcgacttacgtggacttcggtgaaagggaatatttggttgctgatgaa
agaggttacgaatcattgctttataaaatggccgagggctttctctatacctcagatggt
aacattttggacaaccgcctcaaactaaacaaggtggttagggaggtgcaacagtcgagg
aatggtgttgtggtgaaaacagaggatggttccgaatacgaggccaattatgtgatcgtg
tctgctagtattggtgttctccaatccaatcttatctcattccagcctcctttaccgaaa
tggaaaacagaagctatacaaaaatgtgatgtgatggtgtacaccaagatcttcctcaaa
ttccctcattgtttctggccatgtggtcctggccaagagtttttcatctatgcgcacgaa
caacgcggctacttcaccttttggcagcacatggaaaatgcgtacccggggtctaacatt
ctggtcgtgacgttgaccaacgagcagtcaaagcgcgtggagtcccaatccgacgaggag
acactgaaagaggcaatgagtgttctcagggacatgtttggtcccactattccttacgca
actgatattcttgtccctagatggtggaacaaccggtttcagcgcggtagctacagcaat
taccctatgatatctgataaccagcttcaacgaaatgtcaaggctccatttggaaggatt
ttcttcacaggagaacacacaagtgaaaagttcagtggatatgtgcatggaggatacctt
gcgggtatggacacaagcaagactttattggaagagatgaagcagagtttgttgttgcaa
cctttactcgccttcaccgagtctttaacacaaacagaccagcgctctaatcctcaaatg
tacactaatgtcaatttaatatcagggagaagctag

DBGET integrated database retrieval system