KEGG   Brassica napus (rape): 106442742Help
Entry
106442742         CDS       T04128                                 

Definition
(RefSeq) aspartic proteinase A2
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bna01002]
    106442742
Enzymes [BR:bna01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     106442742
Peptidases and inhibitors [BR:bna01002]
 Aspartic peptidases
  Family A1: pepsin family
   106442742
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N SapB_2 SapB_1 TAXi_C DUF3782
Motif
Other DBs
NCBI-GeneID: 106442742
NCBI-ProteinID: XP_013739849
AA seq 509 aa AA seqDB search
MGAYSVTSLFVSFLVFFSASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLK
EFRSNDKNAGDADIVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSL
SCFFHSKYKSSRSSTYKESGKRAAIHYGSGSISGFFSYDAVTVGDLVVKNQEFIEATSEP
GLTFLVAKFDGLLGLGFQEISVGNATPVWYNMLKQGLIKKPVFSFWLNRDTKSEEGGELI
FGGVDPKHFKGEHTYVPVSRRGYWQFDMGEVLIAGKSTGYCGNGCTAIADSGTSLLAGPT
AVIAMINKAIGASGVVSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVS
MGIESVVDKENTKSSSGLRDAGCAPCEMAVVWIQSQLMQNMTQKRIVNNINDICERMPSP
NGESAVDCSQLSKMPTVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGP
LWILGDVFMGRYHTVFDFGNEQVGFAEAA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatactcggttacttcactctttgtgtccttcttggtgtttttctccgcttct
tctgagagcaatgacggaacattaagagttggcctgaaaaaactgaagttggatcctacc
aatcgacttgccacacgctttggttccaagcaagaaaaagcctttcgatcttccttaaaa
gagttccgttcaaacgacaagaatgctggagatgctgacatcgttgcgttgaagaactac
ttggatgctcagtactatggtgagattgctatcggtactccaccacagaagttcacagtg
attttcgacacggggagctctaacctttgggtaccatcagggaaatgttatttctcgctg
tcttgtttctttcattccaagtacaagtcctcgcggtcaagcacttacaaggagagtgga
aaacgtgcagcaatccattacggatctggatccatctctggtttcttcagttatgatgct
gtcacggttggtgacttagttgtcaaaaatcaggagtttattgaggcaaccagtgagcct
ggtttaactttcttggtggctaagtttgatggtcttcttggtcttggattccaagagata
tctgttggaaacgccactcctgtttggtacaatatgctcaagcaaggtcttatcaagaaa
ccagtgttctcattttggcttaaccgtgacacaaagagtgaagaaggcggtgaacttata
tttggcggtgttgatccaaagcacttcaagggagaacacacatatgttcctgtttcacga
aggggttactggcagtttgatatgggtgaggttctcattgccggcaaatctactggatac
tgtggaaatggttgtactgcaatagcagattctggaacatcgttacttgcagggccaaca
gctgtgattgccatgataaataaagctatcggagcatctggagttgttagccagcaatgc
aaaactgttgtggatcagtatggacaaaccattttggatttacttttggctaaggctcaa
ccaaagcatatctgctcaaagataggtctttgcacattcgatggcacccatggggtcagt
atggggattgagtcagtggtggacaaggaaaacacaaagtcatctagcggtctccgagat
gctggttgtgctccatgtgaaatggcagttgtgtggatacaaagccagttaatgcagaac
atgactcaaaagcgtatagtgaacaacattaatgacatatgcgaacgcatgccgagtcct
aatggagagtctgcagtcgactgctcacaactctctaaaatgcctactgtttcattcacc
attggaggcaaagtctttgatctttctccagaagagtacgtactgaagattggggaagga
ccagtggcacaatgcatcagtggctttactgcgctcgacttgcctccacctcgtggacct
ctctggatactgggagatgtgtttatgggaagataccacactgtctttgactttggcaac
gagcaggttggcttcgcagaagctgcgtaa

DBGET integrated database retrieval system