KEGG   Brassica napus (rape): 106445165Help
Entry
106445165         CDS       T04128                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV2-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106445165
   00500 Starch and sucrose metabolism
    106445165
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106445165
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 106445165
NCBI-ProteinID: XP_013742135
AA seq 640 aa AA seqDB search
MYFSSLLFYMNIASKSISLHHRVSSRIINLLTNQIKQNKSVIIDFDAQMSASKIVSLLLL
LVLINISSNDINSVNAFHKVIKKMQSKSTSLEVVSHLHRTGFHFQPPRHWINDPNGPMVY
KGVYHLFYQYNPKGAVWGNIVWAHSVSKDLINWEALEPAIYPSKWFDINGTWSGSATNVP
GKGPVILYTGITENHTQIQNYAIPHDLSDPYLKKWIKPDDNPIVRPDHGENGSAFRDPTT
AWFNKKDGYWRMLVGSKNKRRGIAYMYKSRDFKKWVKTRRPVHTRKATGMWECPDFFPVS
IGKKTGLDTSCDGPNTKHVLKVSLDLTRYEYYTLGTYDTKKDRYKPDGTSPDGWNGLRLD
YGNFYASKTFFDETNNRRILWGWANESDSAVEDTLKGWAGVHLIPRTVLLHSSGKQLVFW
PIEEIESLRGKNVQMNNQKIEMGQRFEVQGITPAQVDVDVTFNVGSLDKAETFDASFATK
PLDLCNLKGSNVTGGVGPFGLITLATSDLQEYTPVFFRVFKDATTNKPKVLMCSDAKPST
LKGDTGTDSTEKMYKPSFAGFVDVDLADGKISLRSLIDHSVVESFGAKGKTVITSRVYPT
KAVGDNAHLFVFNNGSQPVTVESLNAWNMQKPEKMNQGAK
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgtatttttcctccttactcttctacatgaacatcgcatcaaaatctatttctcttcat
cacagagtttcctctcgcataataaatttattaacaaatcaaataaaacaaaataaatcg
gtgatcatagattttgatgcacaaatgagtgcttcaaagattgtttctttgttactattg
cttgtattaatcaatataagcagtaatgatatcaatagcgtcaatgcatttcacaaagtt
atcaagaaaatgcaatctaaatcaacatcgttagaggtagtgagccatcttcacagaacc
ggctttcactttcaacctccacgccattggattaatgatccaaatggtccgatggtgtac
aagggagtctaccatcttttctaccaatacaatcccaaaggtgcggtttggggtaacatt
gtgtgggctcattcagtttctaaggacttgatcaattgggaagctcttgaaccggctatt
tacccctccaaatggtttgatatcaatggtacatggtccggttcagccaccaacgtaccg
ggaaaaggaccggttatcctctacactggtatcactgagaaccatactcagatccaaaac
tatgccattccccatgacctttccgacccatacctcaagaaatggatcaagcccgacgat
aaccctatcgtaagacccgaccatggcgagaatggatccgctttccgtgacccgacaact
gcttggttcaacaaaaaagatgggtactggagaatgcttgtgggctcaaagaacaagcgt
agaggaattgcttatatgtacaaaagtcgcgacttcaagaaatgggtcaaaactagacgt
cccgtacacactagaaaagcaaccggtatgtgggaatgtcccgactttttcccggtttcc
attggcaagaaaaccggtttagacaccagctgtgacggtccaaacaccaagcatgtgttg
aaggttagcttggacctgaccaggtacgagtactacactcttggaacgtatgatactaag
aaggatcgttacaagcctgatggtaccagtcctgatggttggaatggtttgagactagat
tatggtaacttctatgcgtcaaagacattctttgatgaaacaaataacagaagaatcctt
tggggttgggctaatgaatctgatagtgctgtggaagataccttgaagggttgggccggt
gttcatcttatcccaagaactgtcttgcttcactctagtggtaagcaactcgtgttttgg
ccgattgaagaaattgagtcgttgagaggaaagaatgttcaaatgaacaaccagaaaata
gaaatgggtcaacgctttgaggttcaagggatcaccccggcccaggttgatgtggatgtg
acattcaacgtaggaagtctagacaaggcagaaacatttgacgcgagttttgcaacaaaa
ccactagatttatgtaatttgaagggttcaaatgtgactggtggggttggcccttttggt
ctgatcaccttggctacatctgacctacaagaatacactcccgtcttcttcagagtcttc
aaagatgccacaaccaacaagcctaaggtcctcatgtgctctgatgccaagccttcaact
ctcaaaggagacaccggcactgactccacggagaagatgtacaaaccctcgtttgctggt
tttgtcgatgttgatctcgccgacggaaagatatctctaaggagtttgattgatcactcg
gtcgtggaaagctttggagcaaaaggaaagacagtgataacatctcgagtgtatcctacc
aaagctgtaggtgacaacgctcatttgtttgtcttcaacaatgggtcacagcctgtgact
gttgagagcctcaacgcatggaacatgcagaagcccgagaaaatgaaccaaggagctaaa
tga

DBGET integrated database retrieval system