KEGG   Brassica napus (rape): 106445932Help
Entry
106445932         CDS       T04128                                 

Definition
(RefSeq) cysteine--tRNA ligase 2, cytoplasmic-like
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
bna  Brassica napus (rape)
Pathway
bna00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:bna00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    106445932
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bna01007]
    106445932
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bna03016]
    106445932
Enzymes [BR:bna01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     106445932
Amino acid related enzymes [BR:bna01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   106445932
Transfer RNA biogenesis [BR:bna03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    106445932
 Prokaryotic Type
    106445932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1f DALR_2 Rapsyn_N
Motif
Other DBs
NCBI-GeneID: 106445932
NCBI-ProteinID: XP_013743038
AA seq 511 aa AA seqDB search
MEAEKMELKLYNTMTQRKEVFTPINPGKVGLYVCGITAYDFSHIGHARAAVSFDVLYRYL
RHLGYEVNFVRNFTDVDDKIIIRANENGEEPLELSNRFCEEYLVDMGALQCLLPTHQPRV
SDHMDHIIDMIQKIIEKDCGYDVDGDVFFSVDKSPNYGKLSGQLLEHTRAGERVAVDSRK
RNPADFALWKAVKPGEPSWESPWGRGRPGWHIECSAMSAHYLSPKFDIHGGGADLKFPHH
ENELAQTCAACEDGGVNYWLHNGHVTINNEKMAKSKKNFKTIREMTESYHPLALRHFLMS
AHYRSPLSFSASQLDSSSEALYYVYQTLQDLNDALLPYREAMSEDSGKSEQTAEAKDIIN
KLKSEFEGKMLDDLNTAHILTGAYQDALKFINASIGKLKKMQKKQRMSLLVSLVEIEKAA
REVLDVLGLLTTLSYAEILKEMKQKTLTRAGLSEEDISQKIEERIMARKNKEFEKSDEIR
AELTVKGIALMDIGKETVWRPCFPLQANSSD
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgagaagatggagttgaagctgtacaacacgatgacacagcggaaggaagtt
ttcactccgatcaaccccgggaaagtcggattgtacgtctgtggaatcacagcttacgat
ttcagccacatcggccatgctcgcgccgccgtttccttcgacgtcctatacagatacttg
aggcatttgggttatgaagttaatttcgtcaggaatttcacagatgttgatgacaagata
atcatacgtgctaatgagaatggagaggagccgttagagttgagtaatcgcttttgcgag
gagtatttggttgatatgggtgctcttcagtgcctccttcccacccaccagcctcgtgtc
agcgaccatatggatcacattattgacatgattcaaaagatcattgagaaggattgtggg
tatgatgtggacggcgatgtgttcttctccgtcgacaaatcaccaaactatggtaagttg
tcgggtcaactgctggaacatacacgagctggtgagagagttgcggttgattcgagaaag
cgtaaccctgctgattttgcattatggaaggctgtaaaacctggtgagccgagttgggag
agcccgtggggtcgaggaagaccgggatggcacatcgagtgcagtgccatgagtgctcac
tatctgtctcccaaattcgacattcatggtggtggtgcagatttgaaattcccacaccat
gaaaatgagcttgctcagacatgtgctgcttgcgaggatggtggagtgaattactggttg
cataatgggcatgtcactatcaataacgagaagatggctaaatcaaagaaaaacttcaaa
acaatcagagaaatgacagaaagttaccatccactggctctgaggcacttcttgatgagt
gcgcactaccggtctcctctgagcttctcagcgtcacagctagacagttcctctgaagct
ttgtattatgtttatcagacattgcaagatcttaatgatgctctcttgccatatcgagaa
gcaatgtctgaagactctgggaaatctgaacagactgcagaagccaaagacatcattaac
aagctcaaaagtgagtttgaaggaaagatgttagacgatttgaatactgcccatatactg
acgggtgcttaccaagatgcattgaagttcatcaatgcttccatcggcaagctcaagaaa
atgcagaagaaacagaggatgtcactgcttgtgtcactcgttgagattgagaaagcagcc
agggaagttcttgatgtgcttggtttgctcactaccctgagctatgccgagattttgaaa
gaaatgaaacaaaaaacactaacaagggcaggattgagcgaagaagacatttcacaaaag
atagaggaaaggataatggcgaggaagaacaaagagtttgagaaaagtgatgagatcaga
gcagaactgacagttaaaggaatagcattaatggatattggcaaagaaactgtgtggagg
ccatgcttccctcttcaggctaattccagtgattaa

DBGET integrated database retrieval system