KEGG   Brassica napus (rape): 106446778Help
Entry
106446778         CDS       T04128                                 

Definition
(RefSeq) non-specific phospholipase C2
  KO
K01114  phospholipase C [EC:3.1.4.3]
Organism
bna  Brassica napus (rape)
Pathway
bna00562  Inositol phosphate metabolism
bna00564  Glycerophospholipid metabolism
bna00565  Ether lipid metabolism
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106446778
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106446778
   00565 Ether lipid metabolism
    106446778
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:bna02042]
    106446778
Enzymes [BR:bna01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.3  phospholipase C
     106446778
Bacterial toxins [BR:bna02042]
 Type II toxins: Membrane damaging toxins
  Toxins that enzymatically damage the membrane
   106446778
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphoesterase DUF3952
Motif
Other DBs
NCBI-GeneID: 106446778
NCBI-ProteinID: XP_013744020
UniProt: A0A078IDM8
AA seq 546 aa AA seqDB search
MLGEKPKTKVIPTIDYLSIIKVSRLKKMSVQKCISPLATILLLATTILYNNQVHATSPIK
TIVVLVMENRSFDHMLGWMKKLNPEINGVDGSESNPVSASDPSSKKIQFGSGSHYVDPDP
GHSFQAIREQIFGSNDTSKDPPPMNGFVQQAYSEDPTGNMSASVMNGFEPDKVPVYKTLV
SEFAVFDRWFASVPSSTQPNRMFVHSGTSGGATSNDPKSLALGYPQRTIFENLDEADISF
GIYFQNIPAVLFYRNLRKLKYIPKFHSYSLSFKDHAKKGKLPGYAVIEQRYMDTTFEPAN
DDHPSHDVYQGQKFIKEVYETLRASPQWNETLLLITYDEHGGYFDHVPTPVRNVPSPDGI
VGPEPFLFEFNRLGIRVPTIAVSPWIEKGTVVHGPNGSPFPSSEYEHSSIPATVKKLFNL
STPFLTKRDEWAGTFENILQIRKEPRTDCPETLPEPVKIRMTEANENAKLSEFQQELVQL
AAVLKGDDVLTAYPKEIGKGMTVIQGKKYMEDAVKRFLEAGRLALDMGANKEELVHMKPS
LTGRRH
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcttggagagaagcctaagacaaaagttatccccaccattgattatctctctatcatc
aaagtctctcgtctcaagaaaatgtcagtccaaaaatgcatttcaccacttgcaacgatt
ctcctactagcaacaacgattctatacaacaaccaagttcatgcaacaagtccaatcaaa
accatcgtagttttggtaatggaaaatcgatcattcgatcacatgcttggttggatgaaa
aaactaaacccagaaatcaacggcgttgatggttcggagtcgaacccggtctcagcatcg
gacccttcttcaaagaaaatccagttcgggtcaggttcacattacgttgatccggatccg
ggtcattcgtttcaggcgataagggaacagatattcgggtcgaatgatacatccaaagat
cctccaccgatgaacgggtttgttcaacaagcatattcggaggaccccactggtaatatg
tctgcaagtgttatgaatggattcgaacccgataaggttcctgtctacaagacactcgtc
tctgagttcgctgtctttgatagatggtttgcatcggttccatcatcgacgcaaccaaac
cggatgttcgtgcactcaggcacgtcgggaggagccacaagcaacgacccaaagtcactt
gcattaggttatcctcaaagaaccattttcgaaaatcttgatgaagccgatatctctttc
ggaatctacttccagaatattccggcggtattgttttatcgaaacctaaggaaacttaaa
tacattcctaagttccatagctatagcttatccttcaaggatcatgcaaagaaaggaaag
ctccctggttatgctgtgattgagcaacgttacatggatacaacatttgagccagctaat
gatgatcacccatctcatgacgtctaccaaggacagaagtttataaaggaagtgtacgag
acacttagagcgagcccacaatggaacgaaaccctacttttgatcacttacgacgagcac
ggtggatatttcgaccacgttccaacaccagttcgcaatgtgcctagcccggacggtata
gtcggaccagaaccattcctattcgaattcaaccgcttaggtattcgtgtaccaacaata
gctgtgtctccatggatcgagaaaggaacggtcgtacatggaccaaacgggtcaccattc
ccatcatctgaatatgagcattcttcgatcccggcgactgtaaagaaactattcaatcta
tcaacgcctttcctcacaaaaagagatgaatgggcagggacgtttgagaacattttgcaa
atccgaaaagagcctagaactgattgtcccgagacgttacccgaaccggttaagataaga
atgactgaggcgaatgagaatgctaaattgagtgagtttcagcaagagcttgtacaacta
gctgcggttctaaaaggagatgatgtacttacagcatatcctaaagaaataggaaaagga
atgactgtgattcaagggaagaagtatatggaagatgctgtgaaacgattcttagaggct
ggtcgtttagctttagacatgggagcgaataaagaagagcttgttcatatgaaaccttcc
cttactggaagaagacattaa

DBGET integrated database retrieval system