KEGG   Brassica napus (rape): 106447581Help
Entry
106447581         CDS       T04128                                 

Definition
(RefSeq) non-functional pseudokinase ZED1-like
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106447581
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106447581
Protein kinases [BR:bna01001]
 Serine/threonine kinases: TKL group
  IRAK family
   106447581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106447581
NCBI-ProteinID: XP_022574166
AA seq 258 aa AA seqDB search
MLEDRPVLVKKWVIKYSPCSGKTCRDISISSMVSGHKNFLKLLGCCLEFPNPVIVYEYAQ
SIMCREKPKYLFDVSLPWNMRLKIAKEVADALTYLHTAFSKSIIHKDMIPCNIFLDGEGG
TAKLSGFNNSVLIPEGEKFVEDMVVEGTFGYLDHNYMGTGLVTENTDVYGFGAFMITLLT
ALQPSLVVKLYKDSPIELVEDGGFVGIVDPKVLESCKEEETWQFKTFFILSLRCIGCVGE
EVPKMIEVAKELKMIMLV
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaagaccgacccgtgcttgtgaagaaatgggtaataaagtatagtccctgcagc
ggaaagacttgtcgtgacatatccatatcatcaatggttagtggtcacaagaatttcctc
aagctgttaggttgctgtcttgagtttcctaatccagttattgtctatgaatatgcacaa
agtataatgtgtagagaaaagccaaagtatctatttgatgtgagtttaccatggaacatg
agactgaagattgcaaaggaggttgcagacgctttaacatatcttcacactgcattttca
aagagtatcatccacaaagacatgataccatgcaacatcttcttggatggggaaggaggg
acggctaagcttagtgggttcaacaactctgttttgattccggaaggagaaaagtttgtt
gaagatatggttgtagaaggaacttttgggtatcttgatcacaactatatgggtactggg
ctagtgacagagaacactgatgtctatggctttggagcattcatgattactcttttgact
gctttgcaaccgagtcttgttgtcaaactgtacaaggattctcctatagagttggttgaa
gatggtggatttgttgggattgttgatccaaaggtgttggagagctgcaaggaagaagag
acatggcagtttaagactttctttatactctcactgcgatgcattggctgtgtaggagaa
gaagttccaaagatgattgaagttgccaaagaacttaaaatgataatgcttgtttaa

DBGET integrated database retrieval system