KEGG   Brassica napus (rape): 106450213Help
Entry
106450213         CDS       T04128                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV4 precursor
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bna  Brassica napus (rape)
Pathway
bna00052  Galactose metabolism
bna00500  Starch and sucrose metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106450213
   00500 Starch and sucrose metabolism
    106450213
Enzymes [BR:bna01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     106450213
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 106450213
NCBI-ProteinID: NP_001302631
UniProt: A0A078I2C1
AA seq 592 aa AA seqDB search
MGISNIVSVLLLLVLLSLSSNNIKGVEAFHHVYENLQSQSVESVNHLHRTAFHFQPPKHW
INDPNGPVYYKGFYHLFYQYNTKGAVWGNIVWAHSVSKDLVNWEALEHALYPSKWFDIKG
TWSGSITIVPGKGPIILYTGVNQNETQIQNYAIPKDPSDPYLRKWIKPDDNPLVMPDYTM
NGSAFRDPTTAWFSKDGHWRTVVGSKRKHRGIAYIYRSRDFKHWVKGKHPVHSKESTGMW
ECPDFFPVSTTDFQNGLDLDYTGSNTKHVLKVSLDITRFEYYTVGKYDPKKEKYVPNGDT
PDGWDGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDISKGWAGLQVIPRTVLL
DANKKQLVFWPIEEIESLRSNYVRMNNKNIKTGQRLEVKGITPAQADVEVTFNVGQCLDK
AEEFDPSYTFKPLDLCKIKGSNVTGGVGPFGLITLATPDLEEYTPVFFRVFKDTSTDKPK
VLMCSDARPSSLKQDRGPLKQDRMYKPSFAGFVDVDLSDGRISLRSLIDHSVVESFGALG
KTVITSRVYPVKAVKGNAHLYVFNNGTQTVNIESLDAWSMEKPLQMMNNGAL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgggtatctcaaatattgtttctgtgttattattgcttgtactactcagtttaagcagt
aataacatcaaaggggttgaagcttttcatcatgtttacgaaaatttgcaatctcaatca
gtcgagtcagtgaatcatcttcacagaaccgcttttcactttcaacctccaaagcattgg
attaacgatccaaatggtccagtatactacaaaggtttctaccatctcttctaccaatat
aacaccaagggtgcggtttggggcaacatcgtgtgggcacattcggtctccaaagactta
gtaaattgggaggctttagaacatgccctctatccctccaaatggtttgacattaaaggt
acatggtccggttcaataacaatcgtaccgggaaaaggaccgattatcctctatacaggt
gttaaccaaaacgaaactcaaatccaaaactacgcaatcccaaaggacccctcagaccca
tacctaagaaaatggattaaaccagatgataatccgctcgtaatgccagactataccatg
aatggttcagccttccgtgacccgaccacggcatggttctccaaagacgggcattggaga
accgtggttggttcaaaaagaaagcacagagggattgcttatatctacagaagccgagat
tttaagcattgggtcaaaggtaagcacccggttcactccaaagaatcaaccggtatgtgg
gagtgtcctgatttcttcccggtttccacaaccgatttccaaaacggtttggacttggat
tacaccggttcgaacacaaaacacgtgttgaaagttagcttggacataacccgttttgag
tattacacggtggggaagtacgatcctaagaaggagaagtacgtaccaaacggtgataca
cccgatggttgggacggtttgagattcgattatggtaacttctatgcttccaagacattc
tttgactacaaaaagaatagaagaatcttgtggggttgggccaatgaatcggacaccgtt
gaagatgatatctccaagggttgggctggtcttcaggtgattccgagaacggtgcttctt
gatgcaaacaagaagcaactagtgttttggcctattgaagaaatagagtcattaagaagt
aactacgtacgaatgaacaacaaaaacatcaagacgggtcaacgcttagaagtcaaagga
atcactcctgctcaggccgatgtggaagtgacattcaacgtcggacaatgtctagataaa
gctgaggaattcgacccgagctacacattcaaaccgttagatttgtgtaaaataaaaggc
tcgaatgtgacaggtggtgttggacctttcggtttgatcacattggccactcctgatttg
gaagagtacactcctgtcttctttagagtcttcaaagacacttctacagataagcctaag
gttctcatgtgctccgatgctagaccttcatcgttgaagcaagacaggggtccactcaaa
caagataggatgtataaaccatcatttgctgggtttgtggatgttgatctatctgatgga
aggatctctctaaggagtttgattgatcactcggtagtagagagctttggagctttaggg
aaaacagtaataacgtcaagagtgtatccagtgaaagcagtgaaagggaatgcacatttg
tatgtgtttaacaatggaacacaaactgtaaacatagagagtcttgatgcatggagcatg
gagaagcctttgcagatgatgaataatggagctctctaa

DBGET integrated database retrieval system