KEGG   Brassica napus (rape): 106454827Help
Entry
106454827         CDS       T04128                                 

Definition
(RefSeq) cyclin-dependent kinase B2-1-like
  KO
K07760  cyclin-dependent kinase [EC:2.7.11.22]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    106454827
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     106454827
Protein kinases [BR:bna01001]
 Serine/threonine kinases: CMGC group
  CDK family
   106454827
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 106454827
NCBI-ProteinID: XP_013752373
AA seq 161 aa AA seqDB search
MDPKTMRLKIADLGLARAFTLPMKKYNHEILTLWYRAPEVLFGATHYSTAVDMWSVGCVF
AELVTNQAIFAGDSELQQLLHIFRLLGTPNEEMWPGVSTLKNWHAYPQWKPLSLSTSVPK
LDQAGLDLLSKMLQYEPAKRISAKMAMEHPYFDDLPDKSSL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaagacgatgaggctcaagattgcagatcttggtttagccagagccttcact
ctccctatgaagaagtataaccatgagatattgactctatggtatagagctccagaagtt
ctttttggtgccactcattactctacagctgttgatatgtggtctgttggctgcgttttt
gctgagcttgtgaccaaccaagcgatttttgctggagactctgagctccaacagcttctc
catattttcaggttgcttgggacacccaacgaagaaatgtggccaggtgtgagcacactc
aagaactggcacgcgtacccacagtggaagccgttgagtctctccacgtctgttccgaaa
ctcgaccaggctggacttgatcttctctctaaaatgctgcagtatgagccagcgaaacga
atctcagcaaagatggctatggagcatccttacttcgatgatctgcctgacaagtcctct
ctctga

DBGET integrated database retrieval system