KEGG   Brassica napus (rape): 111198514Help
Entry
111198514         CDS       T04128                                 

Definition
(RefSeq) probable glutathione peroxidase 3, mitochondrial
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00480  Glutathione metabolism
bna00590  Arachidonic acid metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111198514
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111198514
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111198514
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 111198514
NCBI-ProteinID: XP_022574052
AA seq 197 aa AA seqDB search
MPRSRTCVLILLLPLAFVFYLYMSLPSPAIVDQSSYSSIYHISVKDIEGNNVSLSKFTGK
VLLIVNVASKCGLTQGNYKELNILYAKYKTKGLEILAFPCNQFGGQEPGSNKEIKENICT
TFKGEFPIFDKIEVNGENASPLYKFLKEQKGGLFGDSIKWNFAKFLVDKQGNVVDRYAPT
TSPLEIEKDIEKLLASA
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctagatcaagaacttgtgtcttaattctcttattgcctctagcctttgtcttctac
ctgtacatgtccctgccttctccagctattgtcgaccaatcatcatacagctccatctac
cacatctctgttaaggacattgaagggaataatgtgagtttaagcaagttcactggaaag
gtgcttcttattgtcaacgtagcctctaagtgtggtttaacacaaggaaactacaaagag
ctgaacattttgtatgccaagtacaaaaccaaggggcttgagatcttagcgtttccgtgc
aaccaatttggaggtcaagagccaggtagcaacaaggagattaaggaaaacatttgcaca
accttcaaaggagagtttcccatctttgacaagattgaagtgaatggagagaatgcttca
cctctatacaagttcttaaaagaacagaaaggcggattgtttggggattctatcaagtgg
aacttcgcaaagtttcttgtagacaaacaagggaatgttgtggatcgatatgctcctaca
acatcacctcttgagattgagaaggacatagagaagctgttggcatctgcttga

DBGET integrated database retrieval system