KEGG   Brassica napus (rape): 111199837Help
Entry
111199837         CDS       T04128                                 

Definition
(RefSeq) proline-rich receptor-like protein kinase PERK12
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    111199837
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111199837
Protein kinases [BR:bna01001]
 Serine/threonine kinases: TKL group
  IRAK family
   111199837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 111199837
NCBI-ProteinID: XP_022546008
AA seq 189 aa AA seqDB search
MGTFGYLAPEYAQSGKLTDRSDVFSFGVVLLELVTGRKPVDQYQPLGEESLVEWARPLLL
KAIETGDFSELIDRRLEKYYVEHEVFRMIETAAACVRHSGPKRPRMVQVVRALDCDEESG
DISNGIKVGQSTTYNSGQYNQDITKFRKMAFGSGDSGEAGMYSGDHSVISSSDFSGNESE
TRPFNNRRF
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggaacatttgggtacttggcaccagaatatgcacaaagcgggaaactgacggataga
tcagatgttttctcatttggggttgttctcttagagcttgtaactggacgcaaaccagtc
gaccagtaccagcctctaggagaagagagtttggtcgaatgggcacgtccgctgcttctg
aaagccattgagactggagatttcagcgaattgatcgatagacgactcgaaaaatattat
gtggagcatgaagtcttcagaatgattgagacagccgctgcatgtgttagacattctggt
cctaaacgtccacgcatggttcaggttgtgagagcattggactgtgatgaggagtcggga
gatattagcaacggaatcaaagttgggcaaagcacaacttataactcagggcagtacaac
caagacatcacgaagttcaggaaaatggcgtttggttctggtgatagcggagaggcaggg
atgtatagtggagatcactctgtcataagctcttctgatttctcagggaatgaatccgag
actcgacctttcaataacagacgtttctaa

DBGET integrated database retrieval system