KEGG   Brassica napus (rape): 111203371Help
Entry
111203371         CDS       T04128                                 

Definition
(RefSeq) ribulose bisphosphate carboxylase small chain F1, chloroplastic-like
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
bna  Brassica napus (rape)
Pathway
bna00630  Glyoxylate and dicarboxylate metabolism
bna00710  Carbon fixation in photosynthetic organisms
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
bna01200  Carbon metabolism
Module
bna_M00165  Reductive pentose phosphate cycle (Calvin cycle)
bna_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
bna_M00532  Photorespiration
bna_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    111203371
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111203371
Enzymes [BR:bna01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     111203371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small RbcS
Motif
Other DBs
NCBI-GeneID: 111203371
NCBI-ProteinID: XP_022552863
AA seq 181 aa AA seqDB search
MASSMLSSATVVSSPAQAAMVAPFTGLKSSAAFPVTRKTNTDITSIASNGGRVNCMKVWP
PVGKKKFETLSYLPDLTDVELAKEVDYLLRNKWIPCVEFELEHGFVYREHGNTPGYYDGR
YWTMWKLPLFGCTDSAQVLKEVQECKTEYPNAFIRIIGFDNNRQVQCISFIAYKPPSFTG
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctctatgctctcctctgccaccgtggttagctcaccggctcaagcggccatg
gttgctccattcacaggcttgaagtcatccgctgcattcccagtcactcgcaagaccaac
actgacattacttccatcgcaagcaatggaggaagagttaactgcatgaaggtgtggcca
ccagtcggaaagaagaagtttgagactctctcttaccttcctgatcttactgacgtcgaa
ttggctaaggaagttgactatcttcttcgcaacaagtggattccttgtgttgaattcgaa
ttggaacatggatttgtataccgtgaacacggaaacacacccggatactacgacggacgt
tactggacaatgtggaaacttcctttgttcggatgcactgactctgctcaagtgttgaag
gaagtgcaagagtgcaagacggaataccctaacgctttcattagaatcatcggattcgac
aacaaccgtcaagtccagtgcatcagtttcatcgcctacaagccaccaagcttcaccggt
gcttaa

DBGET integrated database retrieval system