KEGG   Brassica napus (rape): 111206750
Entry
111206750         CDS       T04128                                 

Definition
(RefSeq) delta(14)-sterol reductase-like
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bna  Brassica napus (rape)
Pathway
bna00100  Steroid biosynthesis
bna01100  Metabolic pathways
bna01110  Biosynthesis of secondary metabolites
Module
bna_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    111206750
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     111206750
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 111206750
NCBI-ProteinID: XP_022559784
AA seq 369 aa
MDLGVLLRSLIPSLQSVYVLVSYFVYLAVAGELLPGKVIRGVVLSDGSQLRYRCNGLFAL
TLLVAILGISAKLGIVSPLVVADRGLELLSATFIFCVLVTLVLYISGRSSSDKTSSLKPH
VSGNLVHDWWFGIQLNPQFLSIDLKFFFVRAGMMGWLLINLSILAKSVQDDSLSQSMILY
QIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNKVQLT
VPAIVANCFVFLIGYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGIARHC
NYLGDLMLALSFSLPCGISSPVPYFYPIYLLILLIWRERRDEVRCAEKYKEIWAEYLRLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcggtgttcttctacggtctctcattccctcattgcaatctgtttacgtgctg
gtgtcttacttcgtttacttggccgttgctggagaacttctccccggaaaagttatccgc
ggcgtcgttttatcagacggctctcagcttcgttaccgatgcaatggtctattcgcactc
acattgctggtcgctatcttgggaatctctgcgaaacttggcatcgtatcacctcttgtg
gttgctgatagaggacttgagctactctctgctacttttatcttctgtgttttggtgaca
ttggtcttgtacatctctgggcgaagttcctcggataagacttcttctctaaagcctcat
gtctcaggaaaccttgtacatgactggtggtttggaatacagctgaatcctcagtttttg
agcatcgatctcaagttcttctttgtcagagccggaatgatgggatggctgctcatcaat
ctctctattctggcaaaaagtgttcaagatgattccttaagtcagtcgatgattctttac
cagattttctgtgcgttatatatattggactactttgttcatgaagaatacatgacctcg
acgtgggacataattgcagagaggttgggcttcatgctggtgtttggagatctcctgtgg
attcctttcacgtttagcattcagggctggtggcttttgcacaataaagtacaactaaca
gttcctgctattgtagccaattgctttgtgttcttgatagggtacatggtttttagaggg
gcaaacaaacaaaaacatatctttaagaagaaccctaaaacacctatatggggtaagcct
ccagtggtggttggtggaaagttgcttgcttcaggctattggggaatcgcaaggcactgt
aattaccttggcgacctgatgcttgcactgtccttcagtttgccctgtggaataagttct
ccggttccatatttctacccgatataccttctgatactgttgatatggagggaacgaaga
gacgaggttcgatgtgcagagaagtacaaggagatttgggctgaatatcttagacttgtc
ccctatagaatcctcccttatgtttattaa

DBGET integrated database retrieval system