KEGG   Brassica napus (rape): 111210620Help
Entry
111210620         CDS       T04128                                 

Definition
(RefSeq) adenylosuccinate synthetase, chloroplastic-like
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
bna  Brassica napus (rape)
Pathway
bna00230  Purine metabolism
bna00250  Alanine, aspartate and glutamate metabolism
bna01100  Metabolic pathways
Module
bna_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111210620
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    111210620
Enzymes [BR:bna01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     111210620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-GeneID: 111210620
NCBI-ProteinID: XP_022566862
AA seq 490 aa AA seqDB search
MSLSSLSFDTKPRFALGGPFNRRHPPLHHPRNSLSYSAKRQAISASLSVAADSTATESIP
RIESLSQVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQGGANAGHTIYNSEGKKFALHL
VPSGILNEDTTCVIGNGVVVHLPGLFKEIDGLESNGVSCKGRILVSDRAHLLFDFHQEVD
GLRESELAKSFIGTTKRGIGPCYSSKVIRNGIRVGDLRHMDTLPQKLDLLLADAAARFPG
FKYTPEMLREEVEAYKRYAERLEPYITDTVHFMNEAISNKKKVLVEGGQATMLDIDFGTY
PFVTSSSPSAGGICTGLGIAPRAVGDLIGVVKAYTTRVGSGPFPTENLGTGGDLLRLAGQ
EFGTTTGRPRRCGWLDLVALKFSCQINGFASLNLTKLDVLSDLNEIQLGVAYKKSDGTRV
DSFPGDLRLLEELEVEYETLPGWNSDISSIRNYADLPKAAQQYVERIEELVGVPIHYIGI
GPGRDALIYK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgtctctctcttctctctccttcgacaccaagccaagattcgccctcggaggcccattc
aaccgccgtcatcctcccctccaccaccctcgtaactccctctcctactcagctaagcgt
caggctatctcagcatcactgagcgtcgccgctgactcaaccgccaccgagtctatacca
cggattgaatcactgagtcaagtatcgggtgtgctaggttgccagtggggagatgaaggc
aaaggcaagctcgttgacatcttagctcagcacttcgacatcgttgctcgttgtcagggt
ggagctaatgctggacacactatatacaactcagaagggaagaagtttgcacttcactta
gtaccttcaggtatactcaacgaggacactacctgtgtaatcggcaacggagttgtggtt
catttaccaggtctcttcaaagagatcgatggtcttgagtccaacggcgtctcctgcaaa
ggaaggatcctggtctcagaccgtgctcatctcttgtttgacttccatcaagaagttgac
ggtctcagagaatccgagctggcaaaatcattcattggcacgaccaagagaggaatcggt
ccttgctactcaagtaaagtgataaggaacggtatcagagttggtgatctaaggcacatg
gacactttgcctcagaagcttgatcttttgctagcagatgcggctgctaggtttccgggg
tttaagtacactccggagatgcttagggaagaggttgaagcgtataagagatacgctgag
aggttggagccgtatataactgacacggttcatttcatgaatgaggcgatttcgaataag
aagaaggttttggttgaaggtggtcaggctactatgttggatattgactttgggacttat
ccttttgttacttcttcgagtccttcggctggtgggatatgcacaggtcttggtatcgct
ccgagagctgttggtgatctaattggagtggtgaaagcatacactactagagttggttca
ggaccgtttcctacggagaatttgggaacaggtggtgaccttcttaggttggctggacaa
gagttcggcactacaactggtcgtcctcgtcggtgtggatggctagaccttgttgcgctg
aaattctcttgccaaatcaatggttttgcatcgcttaatctcaccaagctcgatgtgctt
tcggacctgaacgagattcagcttggtgtggcttacaagaagagtgatggcactcgtgtt
gactctttccctggtgatcttcgccttctcgaagaacttgaagtggagtatgagaccttg
cctggatggaactctgacatttcctcaatcagaaactacgctgatcttccaaaggctgca
cagcaatacgttgagaggattgaagaacttgtgggtgtgcctattcattacattggtatt
ggacctggtcgtgatgcccttatatataaatga

DBGET integrated database retrieval system