KEGG   Brassica napus (rape): 111213377Help
Entry
111213377         CDS       T04128                                 

Definition
(RefSeq) coatomer subunit alpha-1-like
  KO
K05236  coatomer subunit alpha
Organism
bna  Brassica napus (rape)
Brite
KEGG Orthology (KO) [BR:bna00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bna04131]
    111213377
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bna04147]
    111213377
Membrane trafficking [BR:bna04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    111213377
Exosome [BR:bna04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111213377
  Exosomal proteins of bladder cancer cells
   111213377
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COPI_C Coatomer_WDAD SPO22
Motif
Other DBs
NCBI-GeneID: 111213377
NCBI-ProteinID: XP_022570844
AA seq 911 aa AA seqDB search
MIVFKLERERPAFAVSGDSLFYAKDRFLRYYEYSTQKDAQVIPIRRPGTPSLNQSPRTLS
HSPTENAVLICSDLDGGSYELYIIPKDSVGRSDVVQDAKRGTGGSAVFIARNRFAVLEKS
TSQVLVKNLKNEVVKKSSLPIPTDAIFYAGTGNLLCRSEDKVVIFDLQQRLVLGELQTPF
VRYVVWSNDMENVALLSKHTIIIASKKLVLQCTLHETIRVKSGAWDDNGVFIYTTLNHIK
YCLPNGDSGIIRTLDVPIYITKVSGNTIFCLDRDGKNRAITINATEYIFKLALLRKRYDH
VMSMIKNSQLCGQAMIAYLQQKGFPEVALHFVEDERVRFNLALESGNISIAVASATEINE
KEQWYRLGVEALRQGNAGIVEFAYQQTKNFERLSFLYLITGKLDKLSKLMKIAEVKNNVM
GQFHNALYLGDVKERVKILESAGHLPLAYITASVHGLTDTAERLATELGDNVPSLPEGKT
PSLLMPPSPVMCGGDWPLLRVMKGIFEGGLESAARGGAVDEDEEDAGGDWGEGLDMVDVD
GMENRDIEAILAEAEGAEEDNDEEGGWGELEGLDLPPELDTPKASANARSSVFVTPTQGM
PVSHIWSQKSSLAAEQAAAGSFDTAMRLLNRQLGIRNFAPLKSMFIDLFSGSHSYLRAFS
SSPVVPLAIERGWSESNSPNVRGPPALVYDFSQQEEKLKSGYKATTSGKDEKLTEALRLF
LSILHTIPLVVVESRSEVDEVKELVSIAKEYVLGLKMELKRRQKKDDPVRQQELAAYFTH
CNLQLPHLRLALLNAMTVCYKAKNLATAYNFAKRLLETNPLESHARAARQIVQAAERNMT
DATELNYDFRNPFVICGSTYVPIYRGQKDVSCPYCTTRFVPSQEGNICGVCDLAVIGAAA
SGLICSPSQVR
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtgttcaaacttgagagagaacgtcctgcatttgctgtgagtggtgattctctg
ttctatgccaaagatagatttttgaggtactacgaatattcaactcagaaagatgcccaa
gttatccctataaggcgtcctggtacaccaagcttgaatcaaagtccaaggactctatca
cacagtccgacggaaaacgcagttctgatctgctcagatctggatggtggctcgtacgag
ttgtacatcataccgaaagatagtgttggcaggagtgacgttgtgcaagatgcaaagagg
gggacaggtggttctgctgtattcattgcccgtaaccgctttgctgttcttgagaaaagc
accagccaggtgctagtcaagaatctcaagaatgaggtggttaagaagagttctctgcct
atacccacagatgctatcttttatgctgggactggaaatttgctttgtagatcagaggat
aaagtggtaatatttgaccttcagcaaaggcttgttcttggtgaacttcagacaccgttt
gttaggtatgttgtttggtccaacgatatggagaatgttgctttgctcagcaaacacact
atcattattgcgagcaaaaaacttgtcctccagtgcacacttcatgagacaatacgtgtg
aagagtggagcttgggatgacaatggtgtcttcatctacacaactttgaaccatatcaag
tactgtcttcctaatggagatagtgggataatccggaccctggatgtccctatctatatc
accaaggtgtcaggaaacacaatcttttgcttggaccgggatgggaaaaacagggcaatc
accatcaatgcaactgaatacattttcaagcttgcactgctgagaaagagatatgatcat
gtcatgagcatgataaagaactcccagctctgcggacaggctatgattgcttacctgcag
cagaaaggattccctgaagttgccctccattttgttgaagacgagagagtccggttcaac
ctggctcttgaaagtggcaacatcagcatcgctgttgcatccgctacagagattaatgag
aaagagcagtggtatagacttggggtggaggctcttcgccaaggtaatgctggaattgtt
gaatttgcgtaccagcagacgaagaactttgagaggttatcttttctttacctcattact
ggtaagttggacaagctttcaaagttgatgaagattgcagaagtgaagaacaatgtaatg
ggtcagtttcacaatgctctctacctaggagatgttaaagagcgtgtcaagatacttgag
agtgctggtcatttgcctctcgcttatatcactgcttcggttcatggtttaacggacact
gctgagcgacttgcgactgagctaggagacaacgtgccctcgttacctgaggggaaaact
ccgtcgcttttaatgccaccatctcccgtcatgtgtggtggtgattggcctcttctaaga
gtgatgaagggaatatttgaaggcggacttgagagtgcagccagaggaggggctgttgat
gaagatgaagaagatgctggtggtgattggggtgagggacttgacatggtcgatgttgat
ggaatggagaacagagacatcgaagccattttggcggaagcagaaggagcggaagaagat
aatgatgaagaaggtggatggggtgaacttgagggcttggacctcccaccagagcttgac
actcctaaggcctctgctaacgcacgttcatccgtcttcgtgacacctactcaaggtatg
cccgtaagccatatttggagccagaaatcatcacttgccgctgagcaagctgcagctgga
agcttcgacactgcaatgcgtctgctcaacagacagcttggcataaggaactttgcccct
ttgaaatcgatgtttattgatttgttcagtggcagccatagctacctgcgtgctttttct
tcatctcctgtggttccacttgccattgaacgtggatggagcgagtcaaacagtcccaac
gtccgtggcccaccagctcttgtttatgatttctctcagcaagaagagaagctcaaatct
ggctacaaagccacaacaagtgggaaagatgagaaattgactgaggctctccggctcttc
ctctctatcctccacaccatccctctagtggtggtcgagtcaagaagtgaagtagatgag
gttaaggaactggtcagtatcgctaaagaatatgtcctcggtcttaaaatggagctcaag
agaagacagaagaaagatgatccagtgaggcagcaggagcttgctgcttacttcactcac
tgcaacctccaactacctcacttacgactcgcgctgttaaatgcaatgaccgtctgctac
aaggccaagaatctcgccactgcctataacttcgctaaaagattgctggaaaccaaccca
ttggagagccatgccagagcggctagacaaatcgttcaagccgctgaacgcaatatgact
gatgcaaccgagctcaactacgacttcagaaacccgtttgtgatatgcgggtcaacctat
gtcccaatctacagaggtcagaaagacgtttcctgtccgtactgcaccaccaggtttgta
ccgagccaggaaggaaacatatgcggggtctgtgatcttgcagtcattggcgcagccgca
tctggtttgatatgctcgccgtctcaggtccggtga

DBGET integrated database retrieval system