KEGG   Brassica napus (rape): 111213700Help
Entry
111213700         CDS       T04128                                 

Definition
(RefSeq) mitogen-activated protein kinase 8-like
  KO
K20538  mitogen-activated protein kinase 8 [EC:2.7.11.24]
Organism
bna  Brassica napus (rape)
Pathway
bna04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:bna00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    111213700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bna01001]
    111213700
Enzymes [BR:bna01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     111213700
Protein kinases [BR:bna01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   111213700
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 111213700
NCBI-ProteinID: XP_022571232
AA seq 190 aa AA seqDB search
MGGGGNLVEGVRRWLFQRPSSSSSSNNNNPQEPIKKSDTFSNPDHQSELVITEDLDFSGL
KLIKVPKRHHLPMDPQKKGVQEKDFFTEYGEANRYQVQEVVGKGSYGVVASALDTHTGER
VAIKKINDIFEHVSDATRILREIKLLRFLQHPDIVEIKHILLPPSRREFKDIYVVFELME
SDIHQVIKAN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgggtggtggtgggaatctcgtcgagggtgttcgtcgttggctttttcaacgaccttct
tcttcttcttcttccaataataataatcctcaagagcccataaagaagtctgatactttt
tctaatcccgatcatcaatctgagcttgtcattaccgaagatctcgatttctctggtcta
aagcttatcaaagttcccaaacgtcatcacttacccatggatcctcaaaagaagggtgtg
caggaaaaggacttcttcacggagtacggagaagcaaacaggtaccaggttcaagaagtc
gttggtaaaggaagctacggtgtcgtggcctctgctctagacacacacactggcgaaaga
gttgccatcaagaagatcaacgacatcttcgagcacgtctccgacgccacgcgcatcctc
cgcgagatcaaactcctcaggttcctgcagcatccggacatcgtcgagatcaaacacatc
ttgctgccgccttcgaggagagagttcaaggacatttacgtcgttttcgagctcatggag
tctgatattcaccaggttatcaaggcgaat

DBGET integrated database retrieval system