KEGG   Brassica napus (rape): 111215966Help
Entry
111215966         CDS       T04128                                 

Definition
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
bna  Brassica napus (rape)
Pathway
bna00480  Glutathione metabolism
bna00590  Arachidonic acid metabolism
bna01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bna00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111215966
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111215966
Enzymes [BR:bna01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111215966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin Thioredoxin_8
Motif
Other DBs
NCBI-GeneID: 111215966
NCBI-ProteinID: XP_022575944
AA seq 170 aa AA seqDB search
MGASVSVPERSVHQFTVKDSSGKDVNLSIYQGKVLLLVNVASKCGFTESNYTQLTELYRK
YKDQGFEILAFPCNQFLYQEPGTSQEAHEFACTRFQAEYPVFQKVRVNGQNAAPLYKFLK
ASKPTFLGSRIKWNFTKFLVSKDGIVIDRYGTMATPLSIEKDIKKALEEA
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcttctgtttcggttcccgagagatccgtccatcaattcaccgtcaaggatagc
tctggcaaggacgtgaacttgagcatataccaagggaaagtcctcctccttgtcaatgtc
gcttccaaatgcggtttcaccgaatccaattatacccagctcaccgaactttaccggaaa
tacaaggaccaagggtttgagatcttggcgttcccttgcaatcagtttctttaccaagag
cccggcacgagtcaagaggctcatgagtttgcgtgtacgcggtttcaggccgaataccct
gttttccaaaaggtacgtgtaaacggtcaaaacgcagcaccactctacaagttccttaag
gcaagcaagcccacttttcttggttccagaattaagtggaacttcaccaaattcttggtc
agcaaagatggcatagtgattgatcgttacggtacgatggctacaccgctatcaatcgag
aaagacattaaaaaagctctggaagaggcttga

DBGET integrated database retrieval system