KEGG   Bacillus cereus NC7401: BCN_0153Help
Entry
BCN_0153          CDS       T01686                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00220  Arginine biosynthesis
bnc00330  Arginine and proline metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bnc00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BCN_0153
   00330 Arginine and proline metabolism
    BCN_0153
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BCN_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: BAL15946
Position
158248..159141
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFSMHEIDRMGMTAVMEETIAYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNTILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatctcagttattggagttccaatggatttaggacagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgatgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtggatcatattatagaagaaggacgttttccacttgtattaggtggagatcatagtatc
gctattggtacattagctggtgttgcgaaacattataaaaacctaggtgttatttggtat
gacgcacatggcgatttaaatacagaagaaacttcaccatctggaaatattcatggtatg
tcacttgcagcaagtttagggtatggacatccgacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtaattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgaaatgaaggtattaaagtattttcaatgcacgagattgatcgtatg
ggtatgacggctgttatggaagaaacaatcgcgtatttatctcatactgatggtgtgcat
ttatcattagacttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcttatcttatcgtgaaagtcatttagcaatggagatgttagcggaagctgat
attgttacatctgccgagtttgttgaggtaaatacgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system