KEGG   Bacillus cereus NC7401: BCN_0703Help
Entry
BCN_0703          CDS       T01686                                 

Definition
(GenBank) transcriptional activator TenA, putative
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00730  Thiamine metabolism
bnc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    BCN_0703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bnc03000]
    BCN_0703
Enzymes [BR:bnc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     BCN_0703
Transcription factors [BR:bnc03000]
 Prokaryotic type
  Other transcription factors
   Others
    BCN_0703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: BAL16496
Position
782300..782995
Genome map
AA seq 231 aa AA seqDB search
MKFCDRLLETVQPVWEMSHNHPFVVGMGDGTLEKDKFQYYIIQDYLYLLDYAKLYAIGVV
KATNPQVMGKFAEQIDGILNGEMTIHKQYAKRLGISIEEIESAKPSAKNLAYTNYMMSVS
QNGTLAELIAALLPCMWSYWEIGKRLNDIPGARDHEFFGEWIQGYSSEEYGNLCVWLIDL
LNEMAVGKSEKELDRLEEIFLYSSRFEYLFWDMSYRKEMWGFEEQEHTTVS
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttgcgatagattattagaaactgtacaaccagtttgggagatgagtcataat
catccatttgttgtaggtatgggggatggtacgttagaaaaagataagtttcagtattat
attattcaagattatttatacttgttagattatgcaaagttatatgcgatcggtgttgta
aaggcaacaaatccacaagttatggggaaatttgctgaacaaattgatgggatattaaac
ggagaaatgacaattcataaacagtatgcaaaaagacttggaatttctatagaggagata
gagtctgcaaagccatctgctaaaaatttagcttatacaaattacatgatgtctgtatct
caaaatggcacacttgcggaattaatagcagcacttcttccatgtatgtggagctactgg
gagattggaaagcgtttaaatgatattcctggagcaagagatcatgagttctttggtgag
tggattcaaggctatagctctgaagaatatggcaacctttgtgtttggttaatcgattta
ttaaatgaaatggcagttggaaagtctgaaaaagagctagatcgattagaggagattttc
ctatattccagtcgatttgaatatttattctgggatatgtcctaccgtaaggagatgtgg
ggatttgaggagcaagaacatactacagtttcataa

DBGET integrated database retrieval system