KEGG   Bacillus cereus NC7401: BCN_0830Help
Entry
BCN_0830          CDS       T01686                                 

Definition
(GenBank) alcohol dehydrogenase, zinc-containing
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCN_0830
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     BCN_0830
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     BCN_0830
    1.1.1.-  
     BCN_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_assoc Cas_csx3 AlaDh_PNT_C MTH865
Motif
Other DBs
NCBI-ProteinID: BAL16623
Position
896912..897934
Genome map
AA seq 340 aa AA seqDB search
MKAAVWYGEKDIRIEERETKELQPNDVKVKVAWAGICGSDLHAYLHPDSVPMNKNMVIGH
EFSGEIAEVGSLVTKFKEGDRVCIYPMMLKDPSNAETERFITLDAVGAQIDGGFAEYVIL
PQKTIFKIPDNLSLEVAAMVEPAAVSFQSIKDSNVGEGDTVVVYGAGPIGLFAVLGAKAA
GASNIIVVDLFDSRLAKATEVGATHVFNAKEVNPVEEIRKLFPDGADVTIEAAGVESTFN
QAIQSTKVRGTMMVISFHTQDIQFNAPASLLFSGVKLLGSVGYSNETYNEVIQLLANGRL
PAQSIITSKVDIDNIAEQGFEALIHDKAQAKILVKLSGAH
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcagtgtggtatggtgaaaaagatattcgtatcgaggaaagagaaacaaaa
gagttacaacccaatgatgtaaaagttaaagtggcatgggctggtatttgtggttctgat
ttacatgcatacttgcatccagattcagtaccaatgaataagaatatggtaatcggacat
gagttctctggtgaaattgcagaggttggttccctggtaacaaaatttaaagaaggggac
agagtatgtatttatccaatgatgcttaaagatccttcaaatgctgaaactgaacgtttt
atcactttagacgcagtaggtgcacaaatcgacggagggtttgctgaatacgtgatactt
ccacaaaaaacgatttttaaaattccagataatttatcactagaagtagcagcaatggta
gaaccagcagctgtatcattccaatcaattaaggattcaaatgtaggagaaggagatact
gttgttgtttatggcgccggccctattgggctatttgctgttttaggtgcaaaagctgca
ggtgcttctaatattattgttgttgatttatttgatagtcggcttgccaaagcaaccgaa
gtgggtgcgacgcatgtctttaatgctaaagaagtaaaccctgtagaagaaattcgtaaa
ttattcccagatggagcagatgtgacaattgaagctgcaggtgttgagtcaacatttaat
caagccattcaatcaactaaagttcgtggcacaatgatggttatcagcttccatactcaa
gatatccaatttaatgctcctgcttccttactctttagtggcgtaaaattattgggatct
gtggggtacagtaatgaaacttataatgaggtcattcaattactcgctaatggaagatta
cctgcacaatccattattacaagcaaagttgatatagataatattgctgaacaaggtttt
gaagcgttaattcatgataaagcgcaagcaaaaattttagttaaattaagtggcgcacat
taa

DBGET integrated database retrieval system