KEGG   Bacillus cereus NC7401: BCN_1354Help
Entry
BCN_1354          CDS       T01686                                 

Definition
(GenBank) aminoglycoside phophotransferase family protein
  KO
K17910  aminoglycoside 2''-phosphotransferase [EC:2.7.1.190]
Organism
bnc  Bacillus cereus NC7401
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bnc01504]
    BCN_1354
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.190  aminoglycoside 2''-phosphotransferase
     BCN_1354
Antimicrobial resistance genes [BR:bnc01504]
 Gene variants
  Aminoglycoside resistance genes
   O-Phosphotransferases
    BCN_1354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase Pkinase Mg296
Motif
Other DBs
NCBI-ProteinID: BAL17147
Position
complement(1390991..1391893)
Genome map
AA seq 300 aa AA seqDB search
MDSYKQYIKEALPNLSIHSYKQNEEGWDNVAIIVNDELLFRFPRKQEYAMRIPLEKELCT
ILTQSLQEIEVPQYHLIYTNESDEVPLCSYYTLIHGEPLKTEIVANLDEKERKIIITQLA
TFLAALHSIPLKSVTALGFPTEKTLTYWKELQTKLNEYVTNSLTSFQKSTLNRLFENFFA
CLATSKFQNTIIHADFTHHHILFDKQNKTISGIIDFGDAQIGDPAFDFAGLYDDFGHEFT
TSVYEQYCTLTSHHDPLLTHRITNFYQYSPLLHNIIYNFETKNELEFLAGIEQLKAILQG
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggactcctacaaacaatatataaaagaagctttgcctaatctttctatacactcatat
aaacaaaatgaagaaggatgggataatgtagcgattatagtaaatgatgaactactgttt
cgtttcccgcgaaaacaggaatatgcaatgcgaattccgttagaaaaagaactgtgcaca
attctcactcaatcactacaagaaatcgaagttccacaatatcacctaatttatacaaat
gaatctgatgaggttcctctttgtagctactatactctcattcatggtgaaccattaaaa
acagaaatagttgcgaacttagatgaaaaagaacgaaaaataattattacacaattagct
actttccttgcggctctacatagcattcctctaaaaagtgttacagcgttagggttccct
accgaaaaaacacttacctactggaaagagctacaaactaaattaaatgagtatgttact
aacagtctaacttcgttccagaaatcaaccttaaaccgtttattcgagaatttctttgcc
tgtctagctacatccaaatttcaaaatacaatcattcacgctgattttacacatcatcac
attttatttgataaacaaaataaaaccatttcaggaatcattgattttggtgatgctcaa
attggagatcctgcctttgactttgctgggctatatgatgatttcggacatgaatttact
acatcagtatatgaacaatactgtacacttacttcacaccatgatccattactcactcac
cgtatcacaaatttttatcaatacagtcctttactacataatataatttataactttgaa
acaaagaatgaacttgagtttttagctggtatagaacaactgaaagcaatactacaggga
tga

DBGET integrated database retrieval system