KEGG   Bacillus cereus NC7401: BCN_1375Help
Entry
BCN_1375          CDS       T01686                                 

Definition
(GenBank) acetolactate synthase, large subunit, biosynthetic type
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00290  Valine, leucine and isoleucine biosynthesis
bnc00650  Butanoate metabolism
bnc00660  C5-Branched dibasic acid metabolism
bnc00770  Pantothenate and CoA biosynthesis
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
bnc01210  2-Oxocarboxylic acid metabolism
bnc01230  Biosynthesis of amino acids
Module
bnc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
bnc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    BCN_1375
   00660 C5-Branched dibasic acid metabolism
    BCN_1375
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    BCN_1375
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    BCN_1375
Enzymes [BR:bnc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     BCN_1375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N
Motif
Other DBs
NCBI-ProteinID: BAL17168
Position
1404666..1406366
Genome map
AA seq 566 aa AA seqDB search
MSSKTEEKLATGAQLLLEALEKEGVEVIFGYPGGAVLPLYDALYDCEIPHILTRHEQGAI
HAAEGYARITGNPGVVIATSGPGATNVITGLADAMIDSLPLVVFTGQVATTLIGSDAFQE
ADIMGLTMPVTKHNYQVRKASDLPRIIKEAFHIARTGRPGPVVIDLPKDMVVEQGERCSD
VQMDLPGYNPNYEPNLLQINKLLQAIQIANKPLILAGAGVLHAKASKELTSFARKYEIPV
VHTLLGLGGFPPDDELFLGMGGMHGSYTANMALYECDLLINIGARFDDRLTGNLAYFAKE
ATVAHIDIDPAEIGKNVPTEIPIVASAKQALQVLLQPEGRKENHHEWISLLKNRKEKYPF
SYKRNSESIKPQYAIDMLYEITKGEAIVTTDVGQHQMWAAQYYPLKTPDKWVTSGGLGTM
GFGFPAAIGAQIAKPDELVIAIVGDAGFQMTLQELSVLKEHSLPVKVFILNNEALGMVRQ
WQDEFYNKRYSHSLLSCQPDFVALANAYGIKGVRIDDPLLAKKQLQHAIQLQEPVVIDCR
VLQSEKVMPMVAPGKGVHQMEGVEKR
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcaaaaacggaagagaaactggcaactggtgcacagctattgttagaagcgcta
gaaaaggaaggagtagaagtgattttcggttatcctggtggtgctgttttacctctttat
gatgcactctatgactgtgaaattccgcatattttaacgaggcatgaacaaggtgctatt
cacgctgctgaagggtatgccagaattactggcaatccaggggttgtcattgcaacgagt
ggaccaggtgctacaaatgtgattactggtctagcagatgcgatgattgattcattgcca
cttgttgtatttacagggcaagtagcaacaacgttaattggaagcgatgctttccaagaa
gcggatattatggggcttacgatgccagtgacaaaacataactatcaagtgcgaaaggct
tcagatttacctcgaattattaaagaggcatttcatattgctagaacaggaagaccaggc
ccagtcgttattgaccttccgaaagatatggtagtagagcaaggcgaacgatgtagtgat
gtgcaaatggatttaccaggatacaaccctaattatgaaccgaatctactgcaaataaac
aaattattacaagcaattcagattgcaaacaagccattaattttagctggagcaggtgta
ttgcatgcgaaagcttcaaaggaattaacaagttttgctcgtaaatatgaaattcctgtt
gtgcatacattacttggtcttggtgggtttccaccagatgatgaactatttctagggatg
ggaggaatgcatggttcttacacagctaatatggcgttatatgaatgtgacttactcatt
aatataggcgctagattcgatgatcgtcttactggaaatttagcttattttgcgaaagag
gcgactgtcgcgcatatcgatattgatccagcagaaatcgggaaaaatgtaccgactgaa
attcctattgttgcaagtgctaagcaagcgctccaagtattacttcaaccagaaggaagg
aaagaaaatcatcatgagtggatctctttattaaagaatagaaaagaaaagtatccattc
tcttataaacgaaattctgaaagtattaagcctcaatatgcaattgatatgttatatgaa
attacgaagggagaagcgattgtaacaacagatgtggggcaacatcaaatgtgggcagcc
caatattatccgctgaaaactccagataaatgggtaacttcaggaggactaggaacgatg
ggcttcggatttccagcagcaattggtgcccaaattgcaaagcctgatgaattagttatt
gcaattgttggtgacgctggatttcaaatgactctgcaagaattaagtgtgttaaaagaa
cactctttacctgttaaagtatttattttaaataatgaagctttaggaatggtaagacaa
tggcaagatgaattttataacaaaagatattcgcactctttactatcgtgtcaaccagat
ttcgttgctcttgcgaatgcgtatggcataaaaggggttcgcatagatgatccacttctt
gcaaagaaacaattgcagcatgcaattcaattacaagagccagttgtaattgattgccgt
gtacttcaatcagaaaaggtaatgccgatggttgcgccagggaaaggtgttcaccaaatg
gagggagtggaaaaaaggtga

DBGET integrated database retrieval system