KEGG   Bacillus cereus NC7401: BCN_1495Help
Entry
BCN_1495          CDS       T01686                                 

Definition
(GenBank) nucleoside diphosphate kinase, putative
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bnc  Bacillus cereus NC7401
Pathway
bnc00230  Purine metabolism
bnc00240  Pyrimidine metabolism
bnc01100  Metabolic pathways
bnc01110  Biosynthesis of secondary metabolites
bnc01130  Biosynthesis of antibiotics
Module
bnc_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bnc_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bnc_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    BCN_1495
   00240 Pyrimidine metabolism
    BCN_1495
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bnc04131]
    BCN_1495
Enzymes [BR:bnc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     BCN_1495
Membrane trafficking [BR:bnc04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    BCN_1495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: BAL17288
Position
1514502..1514948
Genome map
AA seq 148 aa AA seqDB search
MEKTFLMVKPDGVQRAFIGEIVARFEKKGFQLVGAKLMQVTPEIAGQHYAEHTEKPFFGE
LVDFITSGPVFAMVWQGEGVVDTARNMMGKTRPHEAAPGTIRGDFGVTVAKNIIHGSDSL
ESAEREIGIFFKEEELVDYSKLMNEWIY
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaacatttctaatggttaaaccagacggtgtacaacgtgccttcattggggaa
attgtagctcgttttgagaagaagggctttcaattagttggtgcaaaattaatgcaagtc
actccagaaatcgctggacaacactatgctgagcacacagaaaaacctttctttggtgaa
ttagtagactttattacatctggtcctgtattcgcaatggtatggcaaggtgaaggtgta
gtagatacagctcgtaacatgatgggtaaaacaagaccacatgaagcagctcctggaaca
attcgtggagatttcggtgtaactgttgccaaaaatattatccatggttctgattcgtta
gaaagtgcagagcgcgagattggtattttctttaaggaagaagaattagttgactactca
aaattaatgaatgaatggatttactaa

DBGET integrated database retrieval system