KEGG   Bacillus cereus NC7401: BCN_1953Help
Entry
BCN_1953          CDS       T01686                                 

Definition
(GenBank) NADH:flavin oxidoreductase / NADH oxidase family protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
bnc  Bacillus cereus NC7401
Brite
KEGG Orthology (KO) [BR:bnc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BCN_1953
Enzymes [BR:bnc01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     BCN_1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_FMN Dus G3P_antiterm nsp9
Motif
Other DBs
NCBI-ProteinID: BAL17746
Position
complement(1963280..1964317)
Genome map
AA seq 345 aa AA seqDB search
MNYKLFSPYTIKDVTLKNRIVMSPMCMYSSKNEDGQITNFHLIHYGTRAAGQVGLVMIEA
TAVLPEGRISNKDLGIWDDSLIEGLHKATTFIHDNGAKAAIQLAHAGRKAELETDALAPS
AIPFNETMKMPIEMSKHQIKDTVLAFQQAAVRSKQAGFDVIEIHGAHGYLINEFLSPLTN
KRTDEYGGSPENRYRFLREIIESINEVWNGPLFVRISANDYHPDGLTVQDYVQYTKWMKE
QGVDLIDCSSGAVVPARIDVYPGYQVQYAKHIKEHANIATGAVGLITTGAQAEQILNNNE
ADLIFIGRELLRNPYFSRIAANELGFELEEPYQYERAPGKISTNK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaaacttttttcaccttatacaattaaagacgttacattaaaaaaccggatt
gttatgtcacctatgtgcatgtattcatcgaaaaacgaggatggccaaataacgaatttc
catcttattcattatggaacaagagctgctggtcaagttggtttagttatgattgaagca
acagccgtgttacctgaaggtcgaatttcaaataaagacttaggcatttgggatgacagt
ttaattgaaggcttacataaagcgacaacttttatacacgataatggtgcaaaagctgcc
attcaactcgctcatgctggaagaaaagcagaattagaaacagatgcgttagctccttca
gccattccatttaatgaaacaatgaaaatgccaatagaaatgagcaaacaccaaattaaa
gatactgtattagcttttcagcaagctgcagtacgatccaaacaagctggatttgacgtt
attgaaatacacggtgctcacggttatcttattaatgaatttctttctccacttaccaat
aagcggactgatgaatatggtggttcacctgaaaatcgatatcgtttcttacgcgaaatc
attgaatcgataaatgaagtttggaacggaccgctatttgttcgtatttcagcaaatgat
tatcatcctgacgggttaacagttcaagattatgtacaatatacaaaatggatgaaagaa
caaggagtagatttaatcgattgtagctctggggctgttgtacctgcgcgcatcgatgtt
taccctgggtatcaagtacaatatgctaaacatattaaagagcatgctaacattgcaact
ggtgcagttggattgattacgaccggggcacaagcagagcaaattttaaataataacgaa
gcagatttaatttttatcggacgtgagttacttcgcaatccttacttctcaagaatagcc
gccaatgaacttggctttgaattagaagaaccgtatcaatacgagcgagcgcctgggaaa
atcagtacaaataaataa

DBGET integrated database retrieval system